Clone Name | rbart59e01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PIRL2_ARATH (Q9ZW82) Putative pirin-like protein At2g43120 | 60 | 2e-09 | 2 | PIRL_LYCES (Q9SEE4) Pirin-like protein | 60 | 2e-09 | 3 | PRN1_ARATH (Q9LX49) Pirin 1 (AtPirin1) | 53 | 2e-07 | 4 | PIR_HUMAN (O00625) Pirin | 51 | 8e-07 | 5 | PIRL4_ARATH (Q9LX45) Putative pirin-like protein At3g59260 | 51 | 8e-07 | 6 | PIR_MOUSE (Q9D711) Pirin | 50 | 2e-06 | 7 | PIRL1_ARATH (Q9LPS9) Putative pirin-like protein At1g50590 | 49 | 3e-06 | 8 | Y3240_PSEAE (Q9HZ00) Hypothetical protein PA3240 | 47 | 9e-06 | 9 | Y3769_VIBCH (Q9KKY1) Hypothetical protein VCA0969 | 46 | 2e-05 | 10 | Y2418_PSEAE (Q9I163) Hypothetical protein PA2418 | 44 | 7e-05 | 11 | Y481_CAUCR (P58112) Hypothetical protein CC0481 | 37 | 0.009 | 12 | Y133_THEAC (Q9HLU2) Hypothetical protein Ta0133 | 36 | 0.026 | 13 | FILA_HUMAN (P20930) Filaggrin | 29 | 3.2 | 14 | FMT_CHLCV (Q824Q3) Methionyl-tRNA formyltransferase (EC 2.1.2.9) | 28 | 5.5 | 15 | RPOB_THET8 (Q8RQE9) DNA-directed RNA polymerase beta chain (EC 2... | 28 | 7.2 | 16 | RPOB_THET2 (Q72HM5) DNA-directed RNA polymerase beta chain (EC 2... | 28 | 7.2 |
---|
>PIRL2_ARATH (Q9ZW82) Putative pirin-like protein At2g43120| Length = 296 Score = 59.7 bits (143), Expect = 2e-09 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -3 Query: 363 QPLNEPVVQQGPFVMNSRAQIQQAMEDYYYGRNGFEKA 250 +P+ EPVVQ GPFVMN++A+I +EDY+YG+NGFE A Sbjct: 253 EPIGEPVVQYGPFVMNTQAEIDMTIEDYHYGKNGFEMA 290
>PIRL_LYCES (Q9SEE4) Pirin-like protein| Length = 291 Score = 59.7 bits (143), Expect = 2e-09 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -3 Query: 363 QPLNEPVVQQGPFVMNSRAQIQQAMEDYYYGRNGFEKA 250 QP+NEPVVQ GPFVMN++++I QA +DY G+NGFE++ Sbjct: 248 QPINEPVVQYGPFVMNTKSEIMQAYQDYQLGKNGFERS 285
>PRN1_ARATH (Q9LX49) Pirin 1 (AtPirin1)| Length = 287 Score = 53.1 bits (126), Expect = 2e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 363 QPLNEPVVQQGPFVMNSRAQIQQAMEDYYYGRNGFEKA 250 +P+ EPVVQ GPFVMNS+A+I A +DY +NGFE A Sbjct: 248 EPIGEPVVQCGPFVMNSQAEIDMAFDDYQNAKNGFEMA 285
>PIR_HUMAN (O00625) Pirin| Length = 290 Score = 50.8 bits (120), Expect = 8e-07 Identities = 21/38 (55%), Positives = 29/38 (76%) Frame = -3 Query: 363 QPLNEPVVQQGPFVMNSRAQIQQAMEDYYYGRNGFEKA 250 +PL EPV+Q GPFVMN+ +I QA+ D+ +NGFE+A Sbjct: 244 EPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERA 281
>PIRL4_ARATH (Q9LX45) Putative pirin-like protein At3g59260| Length = 271 Score = 50.8 bits (120), Expect = 8e-07 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = -3 Query: 363 QPLNEPVVQQGPFVMNSRAQIQQAMEDYYYGRNGFEKA 250 +P+ EPVVQ GPFVMNS+ +I+ + DY G NGFE A Sbjct: 228 EPIGEPVVQHGPFVMNSQDEIEMTIGDYRNGMNGFEMA 265
>PIR_MOUSE (Q9D711) Pirin| Length = 290 Score = 49.7 bits (117), Expect = 2e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = -3 Query: 363 QPLNEPVVQQGPFVMNSRAQIQQAMEDYYYGRNGFEKA 250 +PL EPVVQ GPFVMN+ +I QA+ D+ +NGFE A Sbjct: 244 EPLREPVVQHGPFVMNTNEEISQAILDFRNAKNGFEGA 281
>PIRL1_ARATH (Q9LPS9) Putative pirin-like protein At1g50590| Length = 310 Score = 48.9 bits (115), Expect = 3e-06 Identities = 20/38 (52%), Positives = 30/38 (78%) Frame = -3 Query: 363 QPLNEPVVQQGPFVMNSRAQIQQAMEDYYYGRNGFEKA 250 +P+ EP+VQ GPFVMN++ +I + ++D+ RNGFEKA Sbjct: 259 EPIGEPMVQFGPFVMNTQEEIDETIDDFENFRNGFEKA 296
>Y3240_PSEAE (Q9HZ00) Hypothetical protein PA3240| Length = 285 Score = 47.4 bits (111), Expect = 9e-06 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = -3 Query: 363 QPLNEPVVQQGPFVMNSRAQIQQAMEDYYYG 271 +PL+EP+VQ GPFVMNSR +I+QA+ DY G Sbjct: 251 KPLHEPIVQYGPFVMNSREEIEQALRDYRDG 281
>Y3769_VIBCH (Q9KKY1) Hypothetical protein VCA0969| Length = 282 Score = 46.2 bits (108), Expect = 2e-05 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = -3 Query: 363 QPLNEPVVQQGPFVMNSRAQIQQAMEDYYYG 271 QP++EPVV GPFVMNS A+I+QA+ DY G Sbjct: 247 QPIDEPVVHYGPFVMNSMAEIEQAIRDYNAG 277
>Y2418_PSEAE (Q9I163) Hypothetical protein PA2418| Length = 286 Score = 44.3 bits (103), Expect = 7e-05 Identities = 18/32 (56%), Positives = 26/32 (81%) Frame = -3 Query: 363 QPLNEPVVQQGPFVMNSRAQIQQAMEDYYYGR 268 +PL+EP++ GPFVM+SR +I QA+ED+ GR Sbjct: 250 EPLDEPIIGYGPFVMSSREEIDQAIEDFENGR 281
>Y481_CAUCR (P58112) Hypothetical protein CC0481| Length = 276 Score = 37.4 bits (85), Expect = 0.009 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = -3 Query: 363 QPLNEPVVQQGPFVMNSRAQIQQAMEDYYYGR 268 +P+ EPV GPFVM++R + QA +D+ GR Sbjct: 244 RPIGEPVFWHGPFVMDTREGLMQAFDDFQRGR 275
>Y133_THEAC (Q9HLU2) Hypothetical protein Ta0133| Length = 261 Score = 35.8 bits (81), Expect = 0.026 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = -3 Query: 363 QPLNEPVVQQGPFVMNSRAQIQQAMEDYYYGR 268 +PLNEP+ GP VMN+R Q+ QA + G+ Sbjct: 220 KPLNEPIAWYGPIVMNTRDQLIQAFNELQEGK 251
>FILA_HUMAN (P20930) Filaggrin| Length = 4061 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/52 (28%), Positives = 24/52 (46%) Frame = -3 Query: 300 QQAMEDYYYGRNGFEKAXXXXXXXXXXXSHRDDDKHHGALSSKTLGREGKLH 145 QQ+ ++ GR+G E++ +H D HG + T GR+G H Sbjct: 447 QQSHQESTRGRSG-ERSGRSGSSLYQVSTHEQPDSAHGRTGTSTGGRQGSHH 497
>FMT_CHLCV (Q824Q3) Methionyl-tRNA formyltransferase (EC 2.1.2.9)| Length = 321 Score = 28.1 bits (61), Expect = 5.5 Identities = 10/30 (33%), Positives = 22/30 (73%), Gaps = 2/30 (6%) Frame = +2 Query: 47 LYQILSYKAVIKEIIEN--KYYCYILHKGI 130 ++ +++Y A++++++ N KY CY LH G+ Sbjct: 84 VFIVVAYGAILRQVVLNIPKYGCYNLHAGL 113
>RPOB_THET8 (Q8RQE9) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1119 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/23 (56%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -2 Query: 301 PAGHGGLLLRSQRLREGQP-VEL 236 P G GG+++R+ RLR G P VEL Sbjct: 793 PPGEGGIVVRTVRLRRGDPGVEL 815
>RPOB_THET2 (Q72HM5) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1119 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/23 (56%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -2 Query: 301 PAGHGGLLLRSQRLREGQP-VEL 236 P G GG+++R+ RLR G P VEL Sbjct: 793 PPGEGGIVVRTVRLRRGDPGVEL 815 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,911,257 Number of Sequences: 219361 Number of extensions: 884535 Number of successful extensions: 1983 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1960 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1983 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)