| Clone Name | rbart59c05 |
|---|---|
| Clone Library Name | barley_pub |
>TO222_ARATH (Q9FNC9) Mitochondrial import receptor subunit TOM22 homolog 2| (Translocase of outer membrane 22 kDa subunit homolog 2) (Mitochondrial import receptor subunit TOM9-2) (Translocase of outer membrane 9 kDa subunit TOM9-2) Length = 98 Score = 82.8 bits (203), Expect = 2e-16 Identities = 39/50 (78%), Positives = 47/50 (94%) Frame = -2 Query: 347 KLLRSTGKAAWIAGTTFLVLVVPLIIEMDREQQMVDLDLQQQALLGSPPT 198 KLLRSTGKAAWIAGTTFL+LVVPLIIEMDRE Q+ +++LQQ +LLG+PP+ Sbjct: 43 KLLRSTGKAAWIAGTTFLILVVPLIIEMDREAQINEIELQQASLLGAPPS 92
>TO221_ARATH (O64497) Mitochondrial import receptor subunit TOM22 homolog 1| (Translocase of outer membrane 22 kDa subunit homolog 1) (Mitochondrial import receptor subunit TOM9-1) (Translocase of outer membrane 9 kDa subunit TOM9-1) Length = 94 Score = 71.6 bits (174), Expect = 4e-13 Identities = 30/49 (61%), Positives = 44/49 (89%) Frame = -2 Query: 347 KLLRSTGKAAWIAGTTFLVLVVPLIIEMDREQQMVDLDLQQQALLGSPP 201 KLL+STGKAAWIAGTTFL+L VPLI+E++++ ++ ++D +Q +LLG+PP Sbjct: 41 KLLKSTGKAAWIAGTTFLILAVPLILELEQDHRLGEIDFEQASLLGTPP 89
>TOM22_MOUSE (Q9CPQ3) Mitochondrial import receptor subunit TOM22 homolog| (Translocase of outer membrane 22 kDa subunit homolog) Length = 141 Score = 39.3 bits (90), Expect = 0.002 Identities = 18/50 (36%), Positives = 30/50 (60%) Frame = -2 Query: 347 KLLRSTGKAAWIAGTTFLVLVVPLIIEMDREQQMVDLDLQQQALLGSPPT 198 K+ R + A WI T+F++LV+P++ E ++ Q LQQ+ +L P T Sbjct: 75 KMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNT 124
>TOM22_MACFA (Q4R3C7) Mitochondrial import receptor subunit TOM22 homolog| (Translocase of outer membrane 22 kDa subunit homolog) Length = 141 Score = 39.3 bits (90), Expect = 0.002 Identities = 18/50 (36%), Positives = 30/50 (60%) Frame = -2 Query: 347 KLLRSTGKAAWIAGTTFLVLVVPLIIEMDREQQMVDLDLQQQALLGSPPT 198 K+ R + A WI T+F++LV+P++ E ++ Q LQQ+ +L P T Sbjct: 75 KMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNT 124
>TOM22_HUMAN (Q9NS69) Mitochondrial import receptor subunit TOM22 homolog| (Translocase of outer membrane 22 kDa subunit homolog) (hTom22) (1C9-2) Length = 141 Score = 39.3 bits (90), Expect = 0.002 Identities = 18/50 (36%), Positives = 30/50 (60%) Frame = -2 Query: 347 KLLRSTGKAAWIAGTTFLVLVVPLIIEMDREQQMVDLDLQQQALLGSPPT 198 K+ R + A WI T+F++LV+P++ E ++ Q LQQ+ +L P T Sbjct: 75 KMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNT 124
>TOM22_SCHPO (O13813) Mitochondrial import receptor subunit tom22 (Mitochondrial| 22 kDa outer membrane protein) (Translocase of outer membrane 22 kDa subunit) Length = 144 Score = 33.5 bits (75), Expect = 0.13 Identities = 15/52 (28%), Positives = 30/52 (57%) Frame = -2 Query: 347 KLLRSTGKAAWIAGTTFLVLVVPLIIEMDREQQMVDLDLQQQALLGSPPTLA 192 KL + GK+ W+ T+ L+L VP ++ ++ E Q+ + + Q + G+ +A Sbjct: 83 KLAQFGGKSMWVISTSALLLGVPFMMSLEEEAQLTEYEKQIKDQRGANEVIA 134
>TOM22_YEAST (P49334) Mitochondrial import receptor subunit TOM22 (Mitochondrial| 22 kDa outer membrane protein) (Translocase of outer membrane 22 kDa subunit) (Protein MAS17) (Mitochondrial 17 kDa assembly protein) Length = 151 Score = 31.6 bits (70), Expect = 0.48 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = -2 Query: 332 TGKAAWIAGTTFLVLVVPLIIEMDREQQMVDL----DLQQQA 219 +G AW TT L+L VPL + + EQQ++++ DLQ A Sbjct: 94 SGNLAWTLTTTALLLGVPLSLSILAEQQLIEMEKTFDLQSDA 135
>DPP3_RAT (O55096) Dipeptidyl-peptidase 3 (EC 3.4.14.4) (Dipeptidyl-peptidase| III) (DPP III) (Dipeptidyl aminopeptidase III) (Dipeptidyl arylamidase III) Length = 738 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = +1 Query: 1 QDKLVILR*LYRAGEGAVTVTTT 69 Q + VILR L AGEG VTVT T Sbjct: 570 QARFVILRVLLEAGEGLVTVTPT 592
>DPP3_MOUSE (Q99KK7) Dipeptidyl-peptidase 3 (EC 3.4.14.4) (Dipeptidyl-peptidase| III) (DPP III) (Dipeptidyl aminopeptidase III) (Dipeptidyl arylamidase III) Length = 738 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = +1 Query: 1 QDKLVILR*LYRAGEGAVTVTTT 69 Q + VILR L AGEG VTVT T Sbjct: 570 QARFVILRVLLEAGEGLVTVTPT 592
>DPP3_HUMAN (Q9NY33) Dipeptidyl-peptidase 3 (EC 3.4.14.4) (Dipeptidyl-peptidase| III) (DPP III) (Dipeptidyl aminopeptidase III) (Dipeptidyl arylamidase III) Length = 737 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 1 QDKLVILR*LYRAGEGAVTVTTT 69 Q + VILR L AGEG VT+T T Sbjct: 570 QARFVILRVLLEAGEGLVTITPT 592
>DSBE_YERPE (Q8ZD52) Thiol:disulfide interchange protein dsbE (Cytochrome c| biogenesis protein ccmG) Length = 188 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -2 Query: 335 STGKAAWIAGTTFLVLVVPLIIEMDREQQMVDLDLQQQALLGSP 204 S K +I FL+LVV +I++ R D + + AL+G P Sbjct: 6 SFNKLMFIPLVLFLLLVVAFLIQLTRNANGEDPTMLESALIGKP 49
>CCR10_MOUSE (Q9JL21) C-C chemokine receptor type 10 (C-C CKR-10) (CC-CKR-10)| (CCR-10) (Chemokine C-C receptor 9) (G-protein coupled receptor 2) Length = 362 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 198 PRQINLSSCSLPSFTFHFAW 139 PR++ LSSCS P+ T +W Sbjct: 341 PRRLRLSSCSAPTETHSLSW 360 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,431,709 Number of Sequences: 219361 Number of extensions: 616286 Number of successful extensions: 2110 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2095 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2110 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)