>UVRC_CORDI (Q6NH31) UvrABC system protein C (Protein uvrC) (Excinuclease ABC|
           subunit C)
          Length = 687

 Score = 28.5 bits (62), Expect = 4.4
 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 2/38 (5%)
 Frame = +3

Query: 18  YWILGPQ--GTRLTGPYSYTWYSIVTLAVGTNLTTART 125
           Y+  GPQ  G R  GPYS+ W    TL + T +   RT
Sbjct: 118 YFYRGPQRKGVRYYGPYSHAWAVRETLDLLTRVFPIRT 155


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 40,397,789
Number of Sequences: 219361
Number of extensions: 651053
Number of successful extensions: 1507
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1488
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1507
length of database: 80,573,946
effective HSP length: 85
effective length of database: 61,928,261
effective search space used: 1486278264
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)