| Clone Name | rbart59b06 |
|---|---|
| Clone Library Name | barley_pub |
>JI60_HORVU (Q00531) 60 kDa jasmonate-induced protein (EC 3.2.2.22) (rRNA| N-glycosidase) Length = 560 Score = 109 bits (272), Expect = 2e-24 Identities = 56/78 (71%), Positives = 58/78 (74%) Frame = -1 Query: 381 GVHVRPGEPVXXXXXXXXXXXXXXLTIELDLRRGGSGDEIVRGELEFKTAIDGLHTERLV 202 GV VRPGE V LTIELD+R GGSGDEIVRGELEFKTAIDGLHT RLV Sbjct: 483 GVRVRPGELVPLARHALAVPLHMPLTIELDIRHGGSGDEIVRGELEFKTAIDGLHTGRLV 542 Query: 201 GVNGAEFEVTISWSDYPW 148 GVN AEFEVTI WS+YPW Sbjct: 543 GVNDAEFEVTILWSEYPW 560
>NGN3_MOUSE (P70661) Neurogenin 3 (Atonal protein homolog 5) (Helix-loop-helix| protein mATH-4B) (MATH4B) Length = 214 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +2 Query: 146 YQG*SDHEIVTSNSAPLTPT 205 + G SDHE+++SNS P +PT Sbjct: 21 FPGASDHEVLSSNSTPPSPT 40
>KRE2_CANAL (Q00310) Glycolipid 2-alpha-mannosyltransferase (EC 2.4.1.131)| (Alpha-1,2-mannosyltransferase) Length = 431 Score = 28.5 bits (62), Expect = 4.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 386 SRECTCDPGSRFRWRG 339 +R C CDP F WRG Sbjct: 392 ARNCNCDPNKDFTWRG 407
>MEF2D_HUMAN (Q14814) Myocyte-specific enhancer factor 2D| Length = 521 Score = 28.1 bits (61), Expect = 5.3 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +2 Query: 86 LVRSSIVFVVDSSPLVHMDVYQG*SDHEIVTSNSAPLTPTR-RSVCRPSMAVLNSSSP 256 LV S+ ++ SPL H+ + H ++ S P++P+R RS P AV ++ P Sbjct: 407 LVPVSLSNLIPGSPLPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARP 464
>NUP53_HUMAN (Q8NFH5) Nucleoporin NUP53 (Nuclear pore complex protein Nup53)| (Nucleoporin Nup35) (35 kDa nucleoporin) (Mitotic phosphoprotein 44) (MP-44) Length = 326 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 188 APLTPTRRSVCRPSMAVLNSSSPL 259 AP+TP RS+ PS+ V+ SPL Sbjct: 45 APVTPQPRSISGPSVGVMEMRSPL 68
>MEF2D_MOUSE (Q63943) Myocyte-specific enhancer factor 2D| Length = 514 Score = 28.1 bits (61), Expect = 5.3 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +2 Query: 86 LVRSSIVFVVDSSPLVHMDVYQG*SDHEIVTSNSAPLTPTR-RSVCRPSMAVLNSSSP 256 LV S+ ++ SPL H+ + H ++ S P++P+R RS P AV ++ P Sbjct: 400 LVPVSLSNLIPGSPLPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARP 457
>NUP53_RAT (Q68FY1) Nucleoporin NUP53 (Nuclear pore complex protein Nup53)| (Nucleoporin Nup35) (35 kDa nucleoporin) Length = 325 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 188 APLTPTRRSVCRPSMAVLNSSSPL 259 AP+TP RS+ PS+ V+ SPL Sbjct: 45 APVTPQPRSISGPSVGVMEMRSPL 68
>NUP53_MOUSE (Q8R4R6) Nucleoporin NUP53 (Nuclear pore complex protein Nup53)| (Nucleoporin Nup35) (35 kDa nucleoporin) (Mitotic phosphoprotein 44) (MP-44) Length = 325 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 188 APLTPTRRSVCRPSMAVLNSSSPL 259 AP+TP RS+ PS+ V+ SPL Sbjct: 45 APVTPQPRSISGPSVGVMEMRSPL 68
>MTLD_BUCAP (Q8K912) Mannitol-1-phosphate 5-dehydrogenase (EC 1.1.1.17)| Length = 388 Score = 27.3 bits (59), Expect = 9.0 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 8/68 (11%) Frame = +1 Query: 139 GCLPRIVRP*DCHLEFSTIDTN--------KTFRMQAVDGSFELKLASNNFISGSAATKV 294 G + R++ D +L FS +D N K ++++ +D SFE + NN + ++ Sbjct: 14 GFIARVLLKSDFNLIFSDVDQNIINAINNYKKYKIKLIDNSFEKIININNISAINSYDPN 73 Query: 295 KLNRQRHV 318 LN HV Sbjct: 74 VLNVISHV 81 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,160,124 Number of Sequences: 219361 Number of extensions: 964578 Number of successful extensions: 2426 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2372 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2426 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)