Clone Name | rbart59a11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SEC72_SCHPO (Q9P7V5) Protein transport protein sec72 | 30 | 2.2 | 2 | YJE6_YEAST (P47051) Hypothetical 52.1 kDa protein in MTR4-GYP6 i... | 29 | 3.8 | 3 | MTBB_BACSU (P33563) Modification methylase BsuBI (EC 2.1.1.72) (... | 28 | 6.4 | 4 | PDL2_MOUSE (Q9WUL5) Programmed cell death 1 ligand 2 precursor (... | 28 | 6.4 |
---|
>SEC72_SCHPO (Q9P7V5) Protein transport protein sec72| Length = 1822 Score = 29.6 bits (65), Expect = 2.2 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 85 HTTGDGTLQIYTHVVCSDNKTAALMGVNAHGELLSDQKY 201 H G L ++++ +C DN T + +G N +LLS Y Sbjct: 1503 HNLLKGYLWLFSNCICRDNITLSRIGTNCMQQLLSGNAY 1541
>YJE6_YEAST (P47051) Hypothetical 52.1 kDa protein in MTR4-GYP6 intergenic| region Length = 451 Score = 28.9 bits (63), Expect = 3.8 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +3 Query: 69 LEPSIPHNWRWDTANLHS 122 LEPS+P+N W+++ +HS Sbjct: 323 LEPSLPNNMEWESSGVHS 340
>MTBB_BACSU (P33563) Modification methylase BsuBI (EC 2.1.1.72)| (Adenine-specific methyltransferase BsuBI) (M.BsuBI) Length = 501 Score = 28.1 bits (61), Expect = 6.4 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = -1 Query: 183 ELPMSVHPHQSCCLIV*ADYMSVNLQCPISSCVEWRALAAVGEHISLLRN 34 E+ + P+ S L + DY+ +N Q I +EW A + + E L ++ Sbjct: 84 EIDEMLEPYLSETLALFKDYIEINSQIIIDDFIEWAAYSLLDEESLLAKD 133
>PDL2_MOUSE (Q9WUL5) Programmed cell death 1 ligand 2 precursor (Programmed| death ligand 2) (PD-L2) (PD-1-ligand 2) (PDCD1 ligand 2) (Butyrophilin B7-DC) (B7-DC) (CD273 antigen) Length = 247 Score = 28.1 bits (61), Expect = 6.4 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +3 Query: 12 FSTIHVKGFVRGIYAPLQQLEPSIPHNW 95 F H+K I PL ++EP +P W Sbjct: 194 FWNAHMKELTSAIIDPLSRMEPKVPRTW 221 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,615,307 Number of Sequences: 219361 Number of extensions: 582987 Number of successful extensions: 1464 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1464 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)