Clone Name | rbart58g08 |
---|---|
Clone Library Name | barley_pub |
>LAS17_YEAST (Q12446) Proline-rich protein LAS17| Length = 633 Score = 35.0 bits (79), Expect = 0.047 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 135 RRCRQAHTPRRDGRFENY---YSVRGRDTIHVRAHQQPPPPPHDRSTMNSD 278 ++ + H PR + +N Y+ DTI H+ PPPPP T +SD Sbjct: 148 QKSQVVHGPRGESLIDNQRKRYNYEDVDTIPTTKHKAPPPPPPTAETFDSD 198
>INADL_MOUSE (Q63ZW7) InaD-like protein (Inadl protein) (Pals1-associated tight| junction protein) (Protein associated to tight junctions) (Channel-interacting PDZ domain-containing protein) Length = 1834 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 216 HVRAHQQPPPPPHDRSTMNSD*IPSMAAQTDW 311 H+RA + PPPPH R + + + A T W Sbjct: 882 HLRAMESNPPPPHIREAAPASPVLELQAGTQW 913
>YQ5C_CAEEL (Q09466) Putative ABC transporter C16C10.12 in chromosome III| Length = 610 Score = 28.9 bits (63), Expect = 3.4 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 14 NNLHTYARWIKWRAWYWYNAKG 79 NN Y RW++W +W Y +G Sbjct: 526 NNFPVYIRWMQWTSWCRYGFEG 547
>NONO_PONPY (Q5RFL9) Non-POU domain-containing octamer-binding protein (NonO| protein) Length = 471 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 144 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 251 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>NONO_HUMAN (Q15233) Non-POU domain-containing octamer-binding protein (NonO| protein) (54 kDa nuclear RNA- and DNA-binding protein) (p54(nrb)) (p54nrb) (55 kDa nuclear protein) (NMT55) (DNA-binding p52/p100 complex, 52 kDa subunit) Length = 471 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 144 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 251 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>NO75_LUPLU (Q06841) Early nodulin 75 protein (N-75) (NGM-75) (Fragment)| Length = 434 Score = 28.1 bits (61), Expect = 5.8 Identities = 10/23 (43%), Positives = 17/23 (73%), Gaps = 3/23 (13%) Frame = +3 Query: 213 IHVRAHQQPP---PPPHDRSTMN 272 +H +H++PP PPPH++S M+ Sbjct: 267 VHPPSHEKPPFVYPPPHEKSPMH 289
>HYIN1_AGRVI (Q04557) Indoleacetamide hydrolase (EC 3.5.1.-) (IAH)| (Indole-3-acetamide hydrolase) Length = 462 Score = 28.1 bits (61), Expect = 5.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 135 RRCRQAHTPRRDGRFENYYSVRGRDTI 215 RR + + PR +ENYYS G D + Sbjct: 346 RRALRCYKPRLKATYENYYSSNGLDAV 372
>GLB1_MAIZE (P15590) Globulin-1 S allele precursor (GLB1-S) (7S-like)| Length = 573 Score = 27.7 bits (60), Expect = 7.5 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 178 LRTITACAAETRSTYARTSNHHHH--HMIGRR*TAIRFHPWPPR 303 L + CAA ++ NHHHH H GR PW R Sbjct: 9 LLAVLLCAAAAVASSWEDDNHHHHGGHKSGRCVRRCEDRPWHQR 52
>CYTSA_FUGRU (Q2KN94) Cytospin-A| Length = 1118 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -2 Query: 130 FKSASFSQYSTCCTTFPTFCIVPVPRTPFNPA 35 F SAS S + PT P+PRTP +P+ Sbjct: 837 FDSASQGPPSNGASVTPTVSAAPLPRTPLSPS 868
>AGLU_SPIOL (O04893) Alpha-glucosidase precursor (EC 3.2.1.20) (Maltase)| Length = 903 Score = 27.7 bits (60), Expect = 7.5 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 228 HQQPPPPPHDRSTM 269 HQ PPPPPH S++ Sbjct: 109 HQPPPPPPHSLSSL 122
>CYTSA_TETNG (Q2KN95) Cytospin-A| Length = 1113 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -2 Query: 130 FKSASFSQYSTCCTTFPTFCIVPVPRTPFNPA 35 F SAS S+ + PT P+PRTP +P+ Sbjct: 832 FDSASQGPPSSGASVTPTASAAPLPRTPLSPS 863
>ZO3_CANFA (O62683) Tight junction protein ZO-3 (Zonula occludens 3 protein)| (Zona occludens 3 protein) (Tight junction protein 3) Length = 898 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 168 DGRFENYYSVRGRDTIHVRAHQQPPPPPHDRSTMNSD 278 D F + S G + PPPPPH + +++SD Sbjct: 281 DSSFLDDISALGSELSQAVPSHVPPPPPHAQRSLDSD 317
>NRIP1_MOUSE (Q8CBD1) Nuclear receptor-interacting protein 1 (Nuclear factor| RIP140) (Receptor-interacting protein 140) Length = 1161 Score = 27.3 bits (59), Expect = 9.8 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = -3 Query: 213 SCLGRARCNSSQI-CRLSSVCVPAGSVACSSLRVSVSIVPAVLLSLPFALYQYHARHLIQ 37 SC R + +S + R S P SVACS L A+LLS L QY H ++ Sbjct: 236 SCAARLQAVASMVEKRASPAASPKPSVACSQL--------ALLLSSEAHLQQYSREHALK 287
>KP58_DROME (Q9VPC0) Serine/threonine-protein kinase PITSLRE (EC 2.7.11.22)| (Cell division cycle 2-like) Length = 952 Score = 27.3 bits (59), Expect = 9.8 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 217 TYARTSNHHHHHMIGRR*TAIRFHPWP 297 +YA HHH H+ G R +H +P Sbjct: 135 SYAAHHYHHHQHLSGARAAPREYHSYP 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,783,153 Number of Sequences: 219361 Number of extensions: 982993 Number of successful extensions: 4764 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 3621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4304 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)