ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart58g03 |
|---|---|
| Clone Library Name | barley_pub |
>AT11C_HUMAN (Q8NB49) Probable phospholipid-transporting ATPase IG (EC 3.6.3.1)| (ATPase class I type 11C) (ATPase IG) (ATPase IQ) (ATPase class VI type 11C) Length = 1132 Score = 30.4 bits (67), Expect = 1.1 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = -1 Query: 269 YFFFLRIPRYITTWVYVLLCLFVSLFARV 183 YF F ++ ++TW+ ++L +F+SLF + Sbjct: 1057 YFVFAQMLSSVSTWLAIILLIFISLFPEI 1085
>AT11C_MOUSE (Q9QZW0) Probable phospholipid-transporting ATPase 11C (EC 3.6.3.1)| (Fragment) Length = 347 Score = 29.6 bits (65), Expect = 1.9 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = -1 Query: 269 YFFFLRIPRYITTWVYVLLCLFVSLFARV 183 YF F ++ ++TW+ ++L +F+SLF + Sbjct: 285 YFVFAQMLCSVSTWLAIILLIFISLFPEI 313
>VGLM_BUNSH (P04875) M polyprotein precursor [Contains: Glycoprotein G2;| Nonstructural protein NS-M; Glycoprotein G1] Length = 1441 Score = 29.3 bits (64), Expect = 2.4 Identities = 12/50 (24%), Positives = 27/50 (54%), Gaps = 8/50 (16%) Frame = -1 Query: 275 ISYFFFLRIPRYITTWVYVLLCLFVSL--------FARVGRLYEQRCDVF 150 I++++F+ I Y TW +++ L + L F+ + +Y + CD++ Sbjct: 354 INFYYFVCIMNYAVTWGLIIIGLLIGLLFKKYQHRFSNLYAMYCEECDMY 403
>ITPR1_HUMAN (Q14643) Inositol 1,4,5-trisphosphate receptor type 1 (Type 1| inositol 1,4,5-trisphosphate receptor) (Type 1 InsP3 receptor) (IP3 receptor isoform 1) (InsP3R1) (IP3R) Length = 2758 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 Query: 120 LLHNKTKLLEKHITS 164 LLHN KLLEKHIT+ Sbjct: 598 LLHNNRKLLEKHITA 612
>ITPR_DROME (P29993) Inositol 1,4,5-trisphosphate receptor (InsP3 receptor)| (InsP3R) Length = 2838 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 Query: 120 LLHNKTKLLEKHITS 164 LLHN KLLEKHIT+ Sbjct: 622 LLHNNRKLLEKHITA 636
>ITPR2_RAT (P29995) Inositol 1,4,5-trisphosphate receptor type 2 (Type 2| inositol 1,4,5-trisphosphate receptor) (Type 2 InsP3 receptor) (IP3 receptor isoform 2) (InsP3R2) Length = 2701 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 Query: 120 LLHNKTKLLEKHITS 164 LLHN KLLEKHIT+ Sbjct: 598 LLHNNRKLLEKHITA 612
>ITPR2_MOUSE (Q9Z329) Inositol 1,4,5-trisphosphate receptor type 2 (Type 2| inositol 1,4,5-trisphosphate receptor) (Type 2 InsP3 receptor) (IP3 receptor isoform 2) (InsP3R2) (Inositol 1,4,5-trisphosphate type V receptor) Length = 2701 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 Query: 120 LLHNKTKLLEKHITS 164 LLHN KLLEKHIT+ Sbjct: 598 LLHNNRKLLEKHITA 612
>ITPR2_HUMAN (Q14571) Inositol 1,4,5-trisphosphate receptor type 2 (Type 2| inositol 1,4,5-trisphosphate receptor) (Type 2 InsP3 receptor) (IP3 receptor isoform 2) (InsP3R2) Length = 2701 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 Query: 120 LLHNKTKLLEKHITS 164 LLHN KLLEKHIT+ Sbjct: 598 LLHNNRKLLEKHITA 612
>ITPR2_BOVIN (Q8WN96) Inositol 1,4,5-trisphosphate receptor type 2 (Type 2| inositol 1,4,5-trisphosphate receptor) (Type 2 InsP3 receptor) (IP3 receptor isoform 2) (InsP3R2) Length = 2701 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 Query: 120 LLHNKTKLLEKHITS 164 LLHN KLLEKHIT+ Sbjct: 598 LLHNNRKLLEKHITA 612
>ITPR1_MOUSE (P11881) Inositol 1,4,5-trisphosphate receptor type 1 (Type 1| inositol 1,4,5-trisphosphate receptor) (Type 1 InsP3 receptor) (IP3 receptor isoform 1) (InsP3R1) (Inositol 1,4,5-trisphosphate-binding protein P400) (Purkinje cell protein 1) (Pro Length = 2749 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 Query: 120 LLHNKTKLLEKHITS 164 LLHN KLLEKHIT+ Sbjct: 598 LLHNNRKLLEKHITA 612
>ITPR1_RAT (P29994) Inositol 1,4,5-trisphosphate receptor type 1 (Type 1| inositol 1,4,5-trisphosphate receptor) (Type 1 InsP3 receptor) (IP3 receptor isoform 1) (InsP3R1) (IP-3-R) Length = 2750 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 Query: 120 LLHNKTKLLEKHITS 164 LLHN KLLEKHIT+ Sbjct: 598 LLHNNRKLLEKHITA 612
>ITPR1_BOVIN (Q9TU34) Inositol 1,4,5-trisphosphate receptor type 1 (Type 1| inositol 1,4,5-trisphosphate receptor) (Type 1 InsP3 receptor) (IP3 receptor isoform 1) (InsP3R1) Length = 2709 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 Query: 120 LLHNKTKLLEKHITS 164 LLHN KLLEKHIT+ Sbjct: 598 LLHNNRKLLEKHITA 612
>ITPR3_HUMAN (Q14573) Inositol 1,4,5-trisphosphate receptor type 3 (Type 3| inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor) (IP3 receptor isoform 3) (InsP3R3) Length = 2671 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 120 LLHNKTKLLEKHIT 161 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR3_RAT (Q63269) Inositol 1,4,5-trisphosphate receptor type 3 (Type 3| inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor) (IP3 receptor isoform 3) (InsP3R3) (IP3R-3) Length = 2670 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 120 LLHNKTKLLEKHIT 161 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR3_MOUSE (P70227) Inositol 1,4,5-trisphosphate receptor type 3 (Type 3| inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor) (IP3 receptor isoform 3) (InsP3R3) Length = 2670 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 120 LLHNKTKLLEKHIT 161 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>RT03_ACACA (P46754) Mitochondrial ribosomal protein S3| Length = 298 Score = 28.1 bits (61), Expect = 5.4 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -1 Query: 347 FGRLITLVNLFPVLCVMRDV*CSAISYFFFLRIPRYITTW 228 F R L +F + +V + IS FFF+R+ +Y T W Sbjct: 169 FSRSSFLSKIFIIGLSKMNVNANIISEFFFIRLTQYYTIW 208
>ITPR3_BOVIN (Q8WN95) Inositol 1,4,5-trisphosphate receptor type 3 (Type 3| inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor) (IP3 receptor isoform 3) (InsP3R3) Length = 2664 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 120 LLHNKTKLLEKHIT 161 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>POL4_DROME (P10394) Retrovirus-related Pol polyprotein from transposon 412| [Includes: Protease (EC 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Endonuclease] Length = 1237 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 69 GPVLVRTTSDNNNITHILLHNKTKLLEK 152 GP + + DNNNIT + NK +++ K Sbjct: 1202 GPYKIESIGDNNNITLLTNKNKKQIVHK 1229
>M130_STRPU (P08472) Mesenchyme-specific cell surface glycoprotein precursor| (MSP130) Length = 779 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 201 NK*TKQYINPSGNVTWNTKEKKVGNGRALHVTHHT 305 N TK+Y+NP G +T V NG + + + T Sbjct: 202 NNYTKKYVNPEGTITTVRLAGSVSNGPSQQIVNTT 236
>SPO3_SCHPO (Q9US08) Sporulation-specific protein 3| Length = 1028 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = -1 Query: 194 FARVGRLYEQRCDVFF**LCLVM*EYMCNIIVIARGSY*NWAISVIFS 51 F R G +YE+RCD F +Y C I I++ + +I +FS Sbjct: 678 FPRPGEIYEKRCDYFS--------KYACQNIFISKPLKRSGSIYEVFS 717 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,793,255 Number of Sequences: 219361 Number of extensions: 963347 Number of successful extensions: 1884 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1884 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
