Clone Name | rbart58g01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CXX1_HUMAN (O15255) CAAX box protein 1 (Cerebral protein 5) | 31 | 0.69 | 2 | DIA_DROME (P48608) Protein diaphanous | 28 | 4.5 | 3 | SFT2_YEAST (P38166) Protein SFT2 | 28 | 5.9 | 4 | RK16_ADICA (Q85FI5) Chloroplast 50S ribosomal protein L16 | 27 | 10.0 |
---|
>CXX1_HUMAN (O15255) CAAX box protein 1 (Cerebral protein 5)| Length = 209 Score = 31.2 bits (69), Expect = 0.69 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 205 LPCTLGILPASLSCEAHKHPALPRTRLNLV 116 LP ILP L C +H+HP+ P RL L+ Sbjct: 132 LPDDYIILPTDLRCHSHRHPSHPTDRLLLL 161
>DIA_DROME (P48608) Protein diaphanous| Length = 1091 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 108 CDDTKFNRVRGKAGCLCASQLKLAGKI 188 CDD KF+ V GK C Q+ + GK+ Sbjct: 911 CDDDKFSEVMGKFAEECRQQVDVLGKM 937
>SFT2_YEAST (P38166) Protein SFT2| Length = 215 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 287 PTLAAMNKKFGMIHGLSSLANIMSFGSL 204 P LAA +KFG++ + SL +++FG L Sbjct: 103 PVLAAKPRKFGLLWTMGSLLFVLAFGVL 130
>RK16_ADICA (Q85FI5) Chloroplast 50S ribosomal protein L16| Length = 137 Score = 27.3 bits (59), Expect = 10.0 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = -1 Query: 290 NPTLAAMNKKF-GMIHGLSSLANIMSFGSLAMH----SWYLASKLE 168 NP K+ G + G+SS N++SFG A+ +W A ++E Sbjct: 3 NPRRTKYRKQHRGRLRGISSRGNVVSFGKYALQALEPAWITARQIE 48 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,771,919 Number of Sequences: 219361 Number of extensions: 780819 Number of successful extensions: 2054 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2050 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)