| Clone Name | rbart58f11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SPTN5_HUMAN (Q9NRC6) Spectrin beta chain, brain 4 (Spectrin, non... | 28 | 5.6 | 2 | RPOA_LACSS (Q38UT7) DNA-directed RNA polymerase alpha chain (EC ... | 27 | 9.6 |
|---|
>SPTN5_HUMAN (Q9NRC6) Spectrin beta chain, brain 4 (Spectrin, non-erythroid beta| chain 4) (Beta-V spectrin) (BSPECV) Length = 3674 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 302 AAGHRRRRPAMTSRPPPS 249 AAGHR RRP+ R PPS Sbjct: 14 AAGHRSRRPSTELRVPPS 31
>RPOA_LACSS (Q38UT7) DNA-directed RNA polymerase alpha chain (EC 2.7.7.6) (RNAP| alpha subunit) (Transcriptase alpha chain) (RNA polymerase alpha subunit) Length = 312 Score = 27.3 bits (59), Expect = 9.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 83 HKPIQIVRGRIYVAPIRNKIEQFQPGLLPL 172 H + + +GR YVA ++NK + G+LP+ Sbjct: 135 HVRMTVKKGRGYVAAVQNKSDDMPIGVLPI 164 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,331,033 Number of Sequences: 219361 Number of extensions: 756483 Number of successful extensions: 2225 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2193 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2222 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)