Clone Name | rbart58e12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RT51_ASHGO (Q75B48) Mitochondrial 40S ribosomal protein MRP51 (M... | 30 | 1.7 | 2 | KAMA_CLOSU (Q9XBQ8) L-lysine 2,3-aminomutase (EC 5.4.3.2) (KAM) ... | 29 | 3.0 | 3 | RP54_RALEU (P28615) RNA polymerase sigma-54 factor | 28 | 6.6 |
---|
>RT51_ASHGO (Q75B48) Mitochondrial 40S ribosomal protein MRP51 (Mitochondrial| ribosomal protein 51) Length = 360 Score = 30.0 bits (66), Expect = 1.7 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +3 Query: 6 SGFANMKITRWRFARNYIFTSKHVHKQTQGLDSRLATS*PYTNKWIRHHH 155 SGF++ R + + TSK KQ + + ++A P KW++ HH Sbjct: 124 SGFSSRLSARTPLSSFFGLTSKSDAKQWKAAEKKVAALRPAFKKWLQDHH 173
>KAMA_CLOSU (Q9XBQ8) L-lysine 2,3-aminomutase (EC 5.4.3.2) (KAM) (LAM)| Length = 416 Score = 29.3 bits (64), Expect = 3.0 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 5/24 (20%) Frame = -1 Query: 195 LRGHSSSLCVP-----GPGGGGES 139 LRGH+S CVP PGGGG++ Sbjct: 315 LRGHTSGYCVPTFVVDAPGGGGKT 338
>RP54_RALEU (P28615) RNA polymerase sigma-54 factor| Length = 493 Score = 28.1 bits (61), Expect = 6.6 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +2 Query: 65 EQTCTQTNTRLGFKASYELAIH*QMDSPPPPGPGTHNELEC 187 E+ CT+ L F+ AI + S PPG G N EC Sbjct: 177 EEICTELPEELEFEIEEVHAILTLLQSFDPPGVGARNAAEC 217 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,240,121 Number of Sequences: 219361 Number of extensions: 546920 Number of successful extensions: 2138 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2125 length of database: 80,573,946 effective HSP length: 40 effective length of database: 71,799,506 effective search space used: 1723188144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)