Clone Name | rbart58e10 |
---|---|
Clone Library Name | barley_pub |
>CO4_RAT (P08649) Complement C4 precursor [Contains: Complement C4 beta| chain; Complement C4 alpha chain; C4a anaphylatoxin; Complement C4 gamma chain] Length = 1737 Score = 29.3 bits (64), Expect = 2.4 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = -1 Query: 342 ELEEITSWGFVDAMFNIDIEHLDNMNKSKEHGFLGFRNTINSFIAWIDKMKASKDVP 172 E E+TSW FV + F++D+ H +K+H G + + + + +AS DVP Sbjct: 351 EEAELTSWPFVSSAFSLDLSH------TKQHLVPGAPFLLQALVREMSGSEAS-DVP 400
>LRP1_CHICK (P98157) Low-density lipoprotein receptor-related protein 1 precursor| (LRP) (Alpha-2-macroglobulin receptor) (A2MR) Length = 4543 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 228 CYGSRGTHAPCSYSCCPNARCRY*TW 305 C G R P +Y CP+ RC TW Sbjct: 2682 CPGGRKPKCPANYFACPSGRCIPMTW 2707
>SYI_MYCGE (P47587) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 895 Score = 28.9 bits (63), Expect = 3.2 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 6/74 (8%) Frame = -1 Query: 258 KEHGFLGFRNTINSFIAWIDK--MKASKDVP*CSYCLVLYCSLQ----RMPPDPILSLIY 97 +++ FLG IN F+ W+ + KD LYC + R+ +L+ Y Sbjct: 691 EKYNFLGCLKVINKFVLWLSSWYFEIIKD--------TLYCDAKNNPNRLAKQAVLN--Y 740 Query: 96 QFASEISYMLLFVP 55 F IS++ +F+P Sbjct: 741 IFTQLISFLNIFIP 754
>Y434_BUCAP (Q8K9B4) Hypothetical UPF0056 protein BUsg434| Length = 196 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +1 Query: 187 SLHLIDPSDEGVDGVTEAEEPMLLAL 264 ++ +I PSDEG +G + EEP L+ L Sbjct: 84 AIKMIFPSDEGNNGTSSEEEPFLVPL 109
>GPC3_RAT (P13265) Glypican-3 precursor (Intestinal protein OCI-5)| Length = 597 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = +3 Query: 138 KNNRVLDNKSIKEHPWKPXXXXXXXXXXXWCYGSRGTHAPCSYSCCPNARC 290 K+N + + S+ P P C+ S T PC CCP A C Sbjct: 544 KDNEITTSHSVGNMP-SPLKILISVAIYVACFFSWCTDLPCPCLCCPAAPC 593 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,570,300 Number of Sequences: 219361 Number of extensions: 886051 Number of successful extensions: 2042 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2042 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)