Clone Name | rbart58e06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CY561_CAEEL (P34465) Putative cytochrome b561 (Cytochrome b-561) | 28 | 8.7 | 2 | TXP56_PLETR (P36983) Plectoxin-5/6 precursor (Plectoxin V/VI) (P... | 28 | 8.7 |
---|
>CY561_CAEEL (P34465) Putative cytochrome b561 (Cytochrome b-561)| Length = 266 Score = 27.7 bits (60), Expect = 8.7 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 32 VLVFCYRGRTVQTTITESSGWRNNNEVKNGDGCAETSS 145 VL+F + TV I+E + W++ K G CA+ ++ Sbjct: 183 VLIFIFVSITVAMGISERAAWKHTCWTKEGQMCAQQAT 220
>TXP56_PLETR (P36983) Plectoxin-5/6 precursor (Plectoxin V/VI) (PLT-V/PLT-VI)| (PLTVI) Length = 82 Score = 27.7 bits (60), Expect = 8.7 Identities = 11/29 (37%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -1 Query: 101 CSSTLMIQLSLFGQSCLCNR-KPRHVCES 18 C+ +M + ++ GQ+C CN K + CES Sbjct: 51 CNECVMCECNIMGQNCRCNHPKATNECES 79 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,857,957 Number of Sequences: 219361 Number of extensions: 492264 Number of successful extensions: 1227 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1218 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1227 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)