Clone Name | rbart58d09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YCX9_CHLRE (Q32065) Hypothetical 341.7 kDa protein in psbD-psbC ... | 28 | 7.3 | 2 | COCA1_CHICK (P13944) Collagen alpha-1(XII) chain precursor (Fibr... | 28 | 7.3 | 3 | KCNG2_RAT (Q9QYU3) Potassium voltage-gated channel subfamily G m... | 27 | 9.5 | 4 | KCNG2_HUMAN (Q9UJ96) Potassium voltage-gated channel subfamily G... | 27 | 9.5 |
---|
>YCX9_CHLRE (Q32065) Hypothetical 341.7 kDa protein in psbD-psbC intergenic| region (ORF2971) (ORFB) Length = 2971 Score = 27.7 bits (60), Expect = 7.3 Identities = 23/87 (26%), Positives = 31/87 (35%) Frame = -3 Query: 280 NDLRAICFCFTRVCVDANYVSGSPFFATDRQPCFFRILHYLVSSARMQAIIFXPCVPLFV 101 NDL +I +CF + NY+S +T F I R Q+ Sbjct: 447 NDLISIKYCFNNLY---NYISNKTALSTKNLFLFSAIKSNATKHKRTQSFFSVENTTTLG 503 Query: 100 VRRLNTGGHVHSGISTMSIYLNINNVY 20 GH S I+ S YL NV+ Sbjct: 504 NNSNFVKGHFKSSINAFSSYLPSTNVH 530
>COCA1_CHICK (P13944) Collagen alpha-1(XII) chain precursor (Fibrochimerin)| Length = 3124 Score = 27.7 bits (60), Expect = 7.3 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 222 FQDPLFLRQTDSLVFSGFYIIWSPAPG 142 F+ P LR +DS + S F + W PAPG Sbjct: 1087 FKPPRNLRTSDSTM-SSFRVTWEPAPG 1112
>KCNG2_RAT (Q9QYU3) Potassium voltage-gated channel subfamily G member 2| (Voltage-gated potassium channel subunit Kv6.2) (Cardiac potassium channel subunit) Length = 480 Score = 27.3 bits (59), Expect = 9.5 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = -3 Query: 247 RVCVDANYVSGSPFFATDRQPCFFRILHYLVSSARMQAIIFXPCVPLF 104 RVC D + VS FF DR PC FR + L+ + +++ ++ PC F Sbjct: 71 RVCDDYD-VSRDEFFF-DRSPCAFRAIVALLRAGKLR-LLRGPCALAF 115
>KCNG2_HUMAN (Q9UJ96) Potassium voltage-gated channel subfamily G member 2| (Voltage-gated potassium channel subunit Kv6.2) (Cardiac potassium channel subunit) Length = 466 Score = 27.3 bits (59), Expect = 9.5 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = -3 Query: 247 RVCVDANYVSGSPFFATDRQPCFFRILHYLVSSARMQAIIFXPCVPLF 104 RVC D + VS FF DR PC FR + L+ + +++ ++ PC F Sbjct: 57 RVCDDYD-VSRDEFFF-DRSPCAFRAIVALLRAGKLR-LLRGPCALAF 101 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,557,477 Number of Sequences: 219361 Number of extensions: 1017450 Number of successful extensions: 2351 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2351 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)