Clone Name | rbart58b04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IF3X_HUMAN (O75153) Putative eukaryotic translation initiation f... | 28 | 6.9 | 2 | ACCD_SPIOL (Q9M3L7) Acetyl-coenzyme A carboxylase carboxyl trans... | 28 | 9.0 |
---|
>IF3X_HUMAN (O75153) Putative eukaryotic translation initiation factor 3| subunit (eIF-3) Length = 1309 Score = 28.5 bits (62), Expect = 6.9 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +2 Query: 146 QIHAQHARTQLVSIDPSVSWTMNDPPSLNFL 238 +IH +H R L S+DPS ++ D SL+FL Sbjct: 129 RIHVRHVRDLLKSLDPSDAFNGVDCNSLSFL 159
>ACCD_SPIOL (Q9M3L7) Acetyl-coenzyme A carboxylase carboxyl transferase subunit| beta (EC 6.4.1.2) (ACCase beta chain) Length = 522 Score = 28.1 bits (61), Expect = 9.0 Identities = 17/64 (26%), Positives = 27/64 (42%) Frame = +2 Query: 41 HLNRGRKEREQKWTFNNKRRRSEEEAASKK***PIQIHAQHARTQLVSIDPSVSWTMNDP 220 H NRG++ +KW FN+ + E E H + S+ P + + + Sbjct: 23 HANRGQESSMKKWWFNSMLSKKELE------------HGCGLSKSMDSLGPIENTSTKED 70 Query: 221 PSLN 232 PSLN Sbjct: 71 PSLN 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,552,415 Number of Sequences: 219361 Number of extensions: 592099 Number of successful extensions: 1626 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1625 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)