Clone Name | rbart57g02 |
---|---|
Clone Library Name | barley_pub |
>KTHY_PSEAE (Q9HZN8) Thymidylate kinase (EC 2.7.4.9) (dTMP kinase)| Length = 210 Score = 28.9 bits (63), Expect = 5.7 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 9/73 (12%) Frame = -2 Query: 397 MESFVH-DVRRDLALPNLLVIQVGIATAQWQG------NKQGKWLDLVRKE--QRAVRVA 245 +ESFV D+R DL L L +++G+A A +G + ++ + VR+ QRA + Sbjct: 119 LESFVQGDLRPDLTLVFDLPVEIGLARAAARGRLDRFEQEDRRFFEAVRQTYLQRAAQAP 178 Query: 244 NLKYVDAMGLPIA 206 V GLP+A Sbjct: 179 ERYQVLDAGLPLA 191
>NU4M_FELCA (P48916) NADH-ubiquinone oxidoreductase chain 4 (EC 1.6.5.3) (NADH| dehydrogenase subunit 4) Length = 459 Score = 28.9 bits (63), Expect = 5.7 Identities = 13/40 (32%), Positives = 28/40 (70%) Frame = +3 Query: 36 ASHQVSYCYILNQIYSSVVLSTTNLRQTNHQSVDMYASAS 155 A++Q++Y +++ ++ V+ S+ LRQT+ +S+ Y+S S Sbjct: 253 ATNQMAYPFMMLSLWGMVMTSSICLRQTDLKSLIAYSSVS 292
>MOX2R_RAT (Q9ES58) Cell surface glycoprotein OX2 receptor precursor (CD200| cell surface glycoprotein receptor) (OX102 antigen) Length = 327 Score = 28.5 bits (62), Expect = 7.4 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +1 Query: 85 LLCCPQLIFAKLIIRAW-ICMRRRASC 162 LLCCP + K+I+ W I +R + SC Sbjct: 55 LLCCPSISLTKVILITWTITLRGQPSC 81
>PO2F2_MOUSE (Q00196) POU domain, class 2, transcription factor 2| (Octamer-binding transcription factor 2) (Oct-2) (OTF-2) (Lymphoid-restricted immunoglobulin octamer-binding protein NF-A2) Length = 462 Score = 28.1 bits (61), Expect = 9.7 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 85 LLCCPQLIFAKLIIRAWICMRRRASCRAGP 174 LL QL K +IR W C RR+ R P Sbjct: 311 LLIAEQLHMEKEVIRVWFCNRRQKEKRINP 340
>PO2F2_PIG (Q29013) POU domain, class 2, transcription factor 2| (Octamer-binding transcription factor 2) (Oct-2) (OTF-2) (Lymphoid-restricted immunoglobulin octamer-binding protein NF-A2) Length = 478 Score = 28.1 bits (61), Expect = 9.7 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 85 LLCCPQLIFAKLIIRAWICMRRRASCRAGP 174 LL QL K +IR W C RR+ R P Sbjct: 328 LLIAEQLHMEKEVIRVWFCNRRQKEKRINP 357
>PO2F2_HUMAN (P09086) POU domain, class 2, transcription factor 2| (Octamer-binding transcription factor 2) (Oct-2) (OTF-2) (Lymphoid-restricted immunoglobulin octamer-binding protein NF-A2) Length = 478 Score = 28.1 bits (61), Expect = 9.7 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 85 LLCCPQLIFAKLIIRAWICMRRRASCRAGP 174 LL QL K +IR W C RR+ R P Sbjct: 327 LLIAEQLHMEKEVIRVWFCNRRQKEKRINP 356
>GPI1_YEAST (P53306) Phosphatidylinositol N-acetylglucosaminyltransferase GPI1| subunit (EC 2.4.1.198) Length = 609 Score = 28.1 bits (61), Expect = 9.7 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 51 SYCYILNQIYSSVVLSTTNLRQTNHQSVDMYASASIL 161 +YC LN++Y + S NLR T SV + S++ + Sbjct: 144 AYCKALNELYPFIQTSQENLRGTMLNSVAAWCSSTCI 180 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,891,268 Number of Sequences: 219361 Number of extensions: 728079 Number of successful extensions: 2223 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2199 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2223 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)