Clone Name | rbart57b11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | THA11_MOUSE (Q9JJD0) THAP domain-containing protein 11 | 28 | 4.4 | 2 | THA11_HUMAN (Q96EK4) THAP domain-containing protein 11 | 28 | 4.4 | 3 | LEU2_RHOPA (Q6ND69) 3-isopropylmalate dehydratase large subunit ... | 28 | 7.5 | 4 | LEU2_NITWN (Q3SNV3) 3-isopropylmalate dehydratase large subunit ... | 28 | 7.5 |
---|
>THA11_MOUSE (Q9JJD0) THAP domain-containing protein 11| Length = 305 Score = 28.5 bits (62), Expect = 4.4 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 5/56 (8%) Frame = -1 Query: 166 IWIRSVGRWGVALFCF*PLVSCDGPA-CSVN----R*VLCSSFPVVFPCRGRNEKK 14 +W+++V R GV+ CF G CSV+ R P +FP RG NE+K Sbjct: 35 LWLKNVSRAGVS-GCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGVNERK 89
>THA11_HUMAN (Q96EK4) THAP domain-containing protein 11| Length = 313 Score = 28.5 bits (62), Expect = 4.4 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 5/56 (8%) Frame = -1 Query: 166 IWIRSVGRWGVALFCF*PLVSCDGPA-CSVN----R*VLCSSFPVVFPCRGRNEKK 14 +W+++V R GV+ CF G CSV+ R P +FP RG NE+K Sbjct: 35 LWLKNVSRAGVS-GCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGVNERK 89
>LEU2_RHOPA (Q6ND69) 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)| (Isopropylmalate isomerase) (Alpha-IPM isomerase) (IPMI) Length = 469 Score = 27.7 bits (60), Expect = 7.5 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 134 NTPSTDRSNPNPD 172 N P+TDRS PNPD Sbjct: 67 NVPTTDRSKPNPD 79
>LEU2_NITWN (Q3SNV3) 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)| (Isopropylmalate isomerase) (Alpha-IPM isomerase) (IPMI) Length = 468 Score = 27.7 bits (60), Expect = 7.5 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 134 NTPSTDRSNPNPD 172 N P+TDRS PNPD Sbjct: 66 NVPTTDRSKPNPD 78 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,590,526 Number of Sequences: 219361 Number of extensions: 701159 Number of successful extensions: 1562 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1560 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)