Clone Name | rbart57b08 |
---|---|
Clone Library Name | barley_pub |
>NPYR_DROME (P25931) Neuropeptide Y receptor (NPY-R) (PR4 receptor)| Length = 464 Score = 32.0 bits (71), Expect = 0.37 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 9/51 (17%) Frame = -3 Query: 130 WF---ACALP-PTDSVYGVPCITWH-----YLCVTKIPNQSYKLYYTYSLF 5 WF A ALP P S +P WH Y+C P+++ + YYT SLF Sbjct: 229 WFIALATALPIPIVSGLDIPMSPWHTKCEKYICREMWPSRTQEYYYTLSLF 279
>NPY5R_HUMAN (Q15761) Neuropeptide Y receptor type 5 (NPY5-R) (NPY-Y5 receptor)| (Y5 receptor) (NPYY5) Length = 455 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -3 Query: 118 ALPPTDSVYGVPCITWHYLCVTKIPNQSYKLYYTYSL 8 +L +G ++ YLCV P+ SY++ +T SL Sbjct: 189 SLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISL 225
>YNL6_YEAST (P53924) RING finger protein YNL116W| Length = 522 Score = 28.1 bits (61), Expect = 5.3 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 121 CALPPTDSVYGVPCI-TWHYLCVTKIPNQSY 32 C + P +++ PC +WH+ CV ++ SY Sbjct: 438 CKIKPCQAIFISPCAHSWHFRCVRRLVMLSY 468
>NPY5R_MOUSE (O70342) Neuropeptide Y receptor type 5 (NPY5-R) (NPY-Y5 receptor)| (Y5 receptor) Length = 466 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -3 Query: 94 YGVPCITWHYLCVTKIPNQSYKLYYTYSL 8 +G ++ YLCV P+ SY++ +T SL Sbjct: 208 FGSALLSSKYLCVESWPSDSYRIAFTISL 236
>NPY5R_RAT (Q63634) Neuropeptide Y receptor type 5 (NPY5-R) (NPY-Y5 receptor)| (Y5 receptor) Length = 456 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -3 Query: 94 YGVPCITWHYLCVTKIPNQSYKLYYTYSL 8 +G ++ YLCV P+ SY++ +T SL Sbjct: 198 FGSALLSSKYLCVESWPSDSYRIAFTISL 226
>HUNB_DROTA (O46260) Protein hunchback (Fragments)| Length = 192 Score = 27.7 bits (60), Expect = 6.9 Identities = 17/74 (22%), Positives = 29/74 (39%) Frame = +3 Query: 99 ESVGGRAHANHASYISHTCSRR*TTTPHMTPDRRHLKLRDPTQNTKNKIRQMISINRVMN 278 E + H +HA + H S ++PH +P L +P NT ++ Q + + Sbjct: 13 EPISHHHHHHHAHHSHHADSNSNASSPHQSP----LPSPNPPSNTNLQLEQYLKQQQQQQ 68 Query: 279 CNQQRGQSACMHAC 320 Q+ Q C Sbjct: 69 QQHQQQQQPMDTLC 82
>CI041_MOUSE (Q80UY1) Protein C9orf41 homolog| Length = 400 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 64 GSAMLCMVHRTQSQWAG--EHMQTMLPTFPTHVHDARR 171 G++M V+RT+ Q+ E+ Q +LP FP H+ R+ Sbjct: 68 GTSMHERVNRTERQFRSLPENQQKLLPQFPLHLDKIRK 105
>NPY5R_PIG (O97969) Neuropeptide Y receptor type 5 (NPY5-R) (NPY-Y5 receptor)| (Y5 receptor) Length = 446 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -3 Query: 94 YGVPCITWHYLCVTKIPNQSYKLYYTYSL 8 +G ++ YLCV P+ SY++ +T SL Sbjct: 187 FGSAWLSSRYLCVESWPSDSYRIAFTISL 215
>LTBP3_MOUSE (Q61810) Latent transforming growth factor beta-binding protein 3| precursor (LTBP-3) Length = 1268 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 218 ITELEMPSVWCHMWGRRLAS*TCVGNVGSMVCMCSPAH 105 I E MP CH C+ N GS C+C P H Sbjct: 353 INECAMPGNVCHG--------DCLNNPGSYRCVCPPGH 382 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,064,903 Number of Sequences: 219361 Number of extensions: 1102422 Number of successful extensions: 3057 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3056 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)