| Clone Name | rbart57b07 |
|---|---|
| Clone Library Name | barley_pub |
>SERC2_MOUSE (Q8K0E7) Serine incorporator 2 (Tumor differentially expressed| 2-like) Length = 450 Score = 44.3 bits (103), Expect = 7e-05 Identities = 17/30 (56%), Positives = 23/30 (76%) Frame = -3 Query: 363 VWVRIATQWATAGLFIWSLVAPLLFPDREF 274 VWV+I WA L++W+LVAPLL P+R+F Sbjct: 420 VWVKICASWAGLFLYLWTLVAPLLLPNRDF 449
>YK17_SCHPO (Q9HDY3) Membrane protein PB1A10.07c| Length = 441 Score = 41.2 bits (95), Expect = 6e-04 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = -3 Query: 363 VWVRIATQWATAGLFIWSLVAPLLFPDR 280 VWV+I T W GL++WS +AP+ FP R Sbjct: 411 VWVKIITSWVCHGLYVWSCLAPVFFPYR 438
>SERC2_HUMAN (Q96SA4) Serine incorporator 2 (Tumor differentially expressed| 2-like) Length = 456 Score = 40.4 bits (93), Expect = 0.001 Identities = 16/30 (53%), Positives = 22/30 (73%) Frame = -3 Query: 363 VWVRIATQWATAGLFIWSLVAPLLFPDREF 274 VWV+I WA L++W+LVAPLL +R+F Sbjct: 426 VWVKICASWAGLLLYLWTLVAPLLLRNRDF 455
>SERC1_MOUSE (Q9QZI8) Serine incorporator 1 (Tumor differentially expressed| protein 2) (Tumor differentially expressed 1 protein-like) (Membrane protein TMS-2) (Axotomy-induced glyco/Golgi protein 2) Length = 453 Score = 39.3 bits (90), Expect = 0.002 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = -3 Query: 363 VWVRIATQWATAGLFIWSLVAPLLFPDREF 274 VWV+I++ W L++W+LVAPL+ +R+F Sbjct: 423 VWVKISSSWIGLVLYVWTLVAPLVLTNRDF 452
>SERC1_HUMAN (Q9NRX5) Serine incorporator 1 (Tumor differentially expressed| protein 2) (Tumor differentially expressed 1 protein-like) Length = 453 Score = 39.3 bits (90), Expect = 0.002 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = -3 Query: 363 VWVRIATQWATAGLFIWSLVAPLLFPDREF 274 VWV+I++ W L++W+LVAPL+ +R+F Sbjct: 423 VWVKISSSWIGIVLYVWTLVAPLVLTNRDF 452
>SERC3_HUMAN (Q13530) Serine incorporator 3 (Tumor differentially expressed| protein 1) Length = 473 Score = 39.3 bits (90), Expect = 0.002 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = -3 Query: 363 VWVRIATQWATAGLFIWSLVAPLLFPDREF 274 VWV+I++ W L++W+LVAPL+ R+F Sbjct: 443 VWVKISSSWVCLLLYVWTLVAPLVLTSRDF 472
>SERC3_MOUSE (Q9QZI9) Serine incorporator 3 (Tumor differentially expressed| protein 1) (Membrane protein TMS-1) (Axotomy-induced glycoprotein 1) (Axotomy-induced glyco/Golgi protein 1) (AIGP-1) Length = 472 Score = 34.7 bits (78), Expect = 0.059 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -3 Query: 363 VWVRIATQWATAGLFIWSLVAPLLFPDREF 274 VW ++ + W L++W+LVAPL+ R+F Sbjct: 442 VWFKMGSSWLCLLLYLWTLVAPLVLTGRDF 471
>TMS1_YEAST (Q12116) Membrane protein TMS1| Length = 473 Score = 34.7 bits (78), Expect = 0.059 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -3 Query: 360 WVRIATQWATAGLFIWSLVAPLLFPDR 280 WV+I + W L+ W++VAP + PDR Sbjct: 440 WVKIVSAWICYALYGWTVVAPAIMPDR 466
>SO1B2_MOUSE (Q9JJL3) Solute carrier organic anion transporter family member 1B2| (Solute carrier family 21 member 10) (Liver-specific organic anion transporter 1) (LST-1) (SLC21A6) Length = 689 Score = 31.2 bits (69), Expect = 0.65 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 110 CRVWSCIMCDLRHCCQYFNSEDTVFGCIYIEVDLSL 3 C WS C R C+ +NS +FG IY+ + ++L Sbjct: 595 CMKWSVTSCGARGACRLYNSR--LFGMIYVGLSIAL 628
>MAT1_MOUSE (P51949) CDK-activating kinase assembly factor MAT1 (RING finger| protein MAT1) (Menage a trois) (CDK7/cyclin H assembly factor) (p36) (p35) Length = 309 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -2 Query: 313 VPRCSPPVPRQGVLGQPGYLPAKSASSVWSTYVSYRTCFGC 191 + C P VP Q +LG+ GYL A+S Y + C Sbjct: 253 IETCGPQVPEQELLGRLGYLNHVRAASPQDLAGGYTSSLAC 293
>SO1B2_RAT (Q9QZX8) Solute carrier organic anion transporter family member 1B2| (Solute carrier family 21 member 10) (Sodium-independent organic anion-transporting polypeptide 4) (OATP4) (Liver-specific organic anion transporter 1) (rLST-1) Length = 652 Score = 28.1 bits (61), Expect = 5.5 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 110 CRVWSCIMCDLRHCCQYFNSEDTVFGCIYIEVDLSL 3 C WS C R C+ +NS +FG Y+ ++L+L Sbjct: 558 CIKWSVTSCGKRGACRLYNSR--LFGFSYLGLNLAL 591
>BRCA2_MOUSE (P97929) Breast cancer type 2 susceptibility protein homolog (Fanconi| anemia group D1 protein homolog) Length = 3329 Score = 27.7 bits (60), Expect = 7.2 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 337 GNSRPVHLVPRCSPPV-PRQGVLGQPGYLPAKSASSVWSTY 218 GN +P H V R + V QGVL P LP SSV+S + Sbjct: 1971 GNEKPHHSVKRENSVVHSTQGVLSLPKPLPGNVNSSVFSGF 2011
>GLT4_WHEAT (P08489) Glutenin, high molecular weight subunit PW212 precursor| Length = 838 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -2 Query: 355 QDRDPVGNSRPVHLVPRCSPPVPRQGVLGQPGYLPAKS 242 Q + P +P P P P+Q GQPGY P S Sbjct: 349 QGQQPGQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSS 386
>GLT5_WHEAT (P10388) Glutenin, high molecular weight subunit DX5 precursor| Length = 839 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -2 Query: 355 QDRDPVGNSRPVHLVPRCSPPVPRQGVLGQPGYLPAKS 242 Q + P +P P P P+Q GQPGY P S Sbjct: 344 QGQQPGQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSS 381
>ATPF_SYNY3 (P27181) ATP synthase B chain (EC 3.6.3.14) (Subunit I)| Length = 179 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 22 IYIQPKTVSSLLKYWQQCLRSHIMQDQTRQRHKHRLLA 135 IY PKT+ +L +Q + I + +TRQR ++LA Sbjct: 42 IYYAPKTLGKILGDRRQKIADAIEEAETRQRKSAQILA 79
>NIA_USTMA (Q05531) Nitrate reductase [NADPH] (EC 1.7.1.3) (NR)| Length = 908 Score = 27.3 bits (59), Expect = 9.3 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = -2 Query: 337 GNSRPVHLVPRCSPPVPRQGVLGQPGYLPAKSASSVWSTYVSYR-TCFGCDS*ADYLYLV 161 GN + H++ C+P +G+ LP S+ + ++R +CFG D D L LV Sbjct: 825 GNLKVWHVLSNCTPENEANWSMGRGISLPM----SLGAPATNHRQSCFGGDELEDTLALV 880 Query: 160 C 158 C Sbjct: 881 C 881
>LRP4_HUMAN (O75096) Low-density lipoprotein receptor-related protein 4 precursor| (Multiple epidermal growth factor-like domains 7) Length = 1950 Score = 27.3 bits (59), Expect = 9.3 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -2 Query: 334 NSRPVHLVPRCSPPVPR-QGVLGQPGYLPAKSASSVWSTYVSYRT 203 +SRP LVP PP PR G+ + LP ++++S+ RT Sbjct: 1689 DSRPCSLVPGLVPPAPRATGMSEKSPVLPNTPPTTLYSSTTRTRT 1733
>FLGJ_PSEAE (Q9I4P4) Peptidoglycan hydrolase flgJ (EC 3.2.1.-) (Muramidase| flgJ) Length = 400 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 Query: 316 LVPRCSPPVPRQGVLGQPGYLPAKS 242 +VP SP + LGQ YLPA+S Sbjct: 178 IVPSASPAASQMQSLGQDSYLPAQS 202 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,082,879 Number of Sequences: 219361 Number of extensions: 1096914 Number of successful extensions: 2893 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 2774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2888 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)