| Clone Name | rbart57b06 |
|---|---|
| Clone Library Name | barley_pub |
>OXAA_CLOAB (Q97CW0) Membrane protein oxaA| Length = 254 Score = 29.6 bits (65), Expect = 1.9 Identities = 15/61 (24%), Positives = 29/61 (47%) Frame = +3 Query: 105 FNRTKLEPISPSILTIFCYRLAKLVVH*HPSVHTPGVGWVYIHNLGCETTGTRVHRFTRW 284 + + P +L I Y + + + S+H G+G+++IH+L + T F+ W Sbjct: 91 YKEKNVNPFGGCLLLIIQYPILIALYYVFYSLHIKGIGFLWIHDLSQKAT------FSNW 144 Query: 285 T 287 T Sbjct: 145 T 145
>CYSI_VIBCH (Q9KUX3) Sulfite reductase [NADPH] hemoprotein beta-component (EC| 1.8.1.2) (SIR-HP) (SIRHP) Length = 577 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 34 YSQRLFNFTFEPLSSTDEVTTQPISTEQSW 123 Y +R +F F PL T EV +ST++ W Sbjct: 272 YPRRADDFGFIPLEKTLEVAAAVVSTQRDW 301
>KNS1_YEAST (P32350) Dual specificity protein kinase KNS1 (EC 2.7.12.1)| Length = 737 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 50 STSPLNHFPAQMKSLPNQFQQNKVGTDFAK 139 STSP ++ PAQ+ SLP + ++G+ K Sbjct: 245 STSPFSNPPAQIASLPQSNLKKQIGSSLRK 274
>PTPRZ_HUMAN (P23471) Receptor-type tyrosine-protein phosphatase zeta precursor| (EC 3.1.3.48) (R-PTP-zeta) Length = 2314 Score = 27.7 bits (60), Expect = 7.1 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = -2 Query: 332 SGMAELPRTVADASSRPPCKTMNPGSCCFAAQIVYINPPHT-RGMNAGMS 186 SG ++P T +++S+P K +Q V PPHT G +A ++ Sbjct: 490 SGKGDVPNTSLNSTSQPVTKLATEKDISLTSQTVTELPPHTVEGTSASLN 539
>GA2L2_HUMAN (Q8NHY3) GAS2-like protein 2 (Growth arrest-specific 2-like 2)| (GAS2-related protein on chromosome 17) (GAR17 protein) Length = 880 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -1 Query: 258 FLLFRSPDCVYKPTPHQGYERWDVSGPP 175 F FR P+ V PTP QG + + PP Sbjct: 482 FFQFREPESVRSPTPVQGLTKIPIRLPP 509
>CCNT1_MOUSE (Q9QWV9) Cyclin-T1 (Cyclin-T) (CycT1)| Length = 724 Score = 27.3 bits (59), Expect = 9.3 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Frame = -2 Query: 335 LSGMAELPRTVADAS----SRPPCKTMNPGSCCFAAQIVYINPPHTRGMNAGMSVDHQ 174 L M +LP +D S S+P CKT P + PP G NA S+D+Q Sbjct: 605 LPTMTQLPGHSSDTSGLPFSQPSCKTRVPH------MKLDKGPPGANGHNATQSIDYQ 656 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,077,079 Number of Sequences: 219361 Number of extensions: 1336126 Number of successful extensions: 3116 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3116 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)