| Clone Name | rbart57a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MFP1_TOBAC (Q9M7J4) MAR binding filament-like protein 1-1 | 33 | 0.53 | 2 | CKLF_MOUSE (Q9DAS1) Chemokine-like factor | 29 | 5.9 | 3 | YBOX1_XENLA (P21573) Nuclease sensitive element-binding protein ... | 29 | 7.7 |
|---|
>MFP1_TOBAC (Q9M7J4) MAR binding filament-like protein 1-1| Length = 722 Score = 32.7 bits (73), Expect = 0.53 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 2/93 (2%) Frame = +3 Query: 78 QGKKDLCRTLQPDV--YTR*KLSKELTFPPLKNK*KDCRCVVHTIASRRGPTILTAARLR 251 Q K++L R L ++ ++ KL ++T L+ D + + R A + Sbjct: 408 QEKENLRRMLDAELENISKLKLEVQVTQETLEKSRSDASDIAQQLQQSRHLCSKLEAEVS 467 Query: 252 AYSMEIEKPKISYFRKVDDTKRNA*ATHAVLTS 350 ME+E+ + S R +D+TKR A A LT+ Sbjct: 468 KLQMELEETRTSLRRNIDETKRGAELLAAELTT 500
>CKLF_MOUSE (Q9DAS1) Chemokine-like factor| Length = 152 Score = 29.3 bits (64), Expect = 5.9 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 4/54 (7%) Frame = -3 Query: 175 YLFFRGGNVSSLLSFYLVYTSGCNVRHRSFLPWPL----NSLVPPHVGILIAVL 26 Y+ G V+ + F ++YT G + RSF WPL NS+V ++++VL Sbjct: 45 YIVITGFEVTVIFCFLVLYTCGLDKIMRSFF-WPLLDVINSMVTALCMLIVSVL 97
>YBOX1_XENLA (P21573) Nuclease sensitive element-binding protein 1 (Y-box| binding protein 1) (Y-box transcription factor) Length = 303 Score = 28.9 bits (63), Expect = 7.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 350 QVPWTRQYRRNYRYHQECGKKPGSKEGAE 436 Q P R+YRRN+ Y + + P S++G E Sbjct: 253 QPPPQRRYRRNFNYRRRRPENPKSQDGKE 281 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,145,727 Number of Sequences: 219361 Number of extensions: 1456489 Number of successful extensions: 3402 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3402 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)