| Clone Name | rbart56g08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LPLB_BACSU (P39128) Protein lplB | 33 | 0.14 | 2 | Y535_METJA (Q57955) Hypothetical protein MJ0535 | 29 | 3.4 | 3 | DYHC_SCHPO (O13290) Dynein heavy chain, cytosolic (DYHC) | 28 | 5.8 |
|---|
>LPLB_BACSU (P39128) Protein lplB| Length = 318 Score = 33.5 bits (75), Expect = 0.14 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 8/65 (12%) Frame = +2 Query: 134 VVNEQIMYLNGTVVSFL-----FPPMFLLAPV---ASWNYVFSLAALNSLMTFSYTTNVT 289 V+N+ IM L G +SFL F PM ++ + W + LAAL ++ Y + Sbjct: 156 VINKLIMSLTGEQISFLSDADWFRPMIVMQSIWKETGWGTILFLAALATVDQEQYEAAIM 215 Query: 290 EAAGR 304 + AGR Sbjct: 216 DGAGR 220
>Y535_METJA (Q57955) Hypothetical protein MJ0535| Length = 343 Score = 28.9 bits (63), Expect = 3.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 148 DYVFEWNSSIFPISSYVSP 204 DY+F WN + PI +Y SP Sbjct: 224 DYIFAWNEIVEPILNYFSP 242
>DYHC_SCHPO (O13290) Dynein heavy chain, cytosolic (DYHC)| Length = 4196 Score = 28.1 bits (61), Expect = 5.8 Identities = 26/84 (30%), Positives = 43/84 (51%), Gaps = 1/84 (1%) Frame = -3 Query: 309 KSLPAASVTFVVYENVIKLFRAAKEK-T*FQLATGARRNIGGNRKDTTVPFKYIICSFTT 133 K+L +++ V + ++ L + KEK +LA ++I NRK + +Y + + Sbjct: 3665 KTLCSSNENIVGTDEIVVLLKNLKEKHETIRLAYSESQSI--NRKVDELIRRYKLSIKSF 3722 Query: 132 LSELDVMFHHISQFSSYSFNTNGI 61 LS + V H IS SYSF+ N I Sbjct: 3723 LSVVVVFQHFISLKKSYSFSFNFI 3746 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,498,112 Number of Sequences: 219361 Number of extensions: 720421 Number of successful extensions: 1656 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1655 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)