Clone Name | rbart56g01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | EFG1_TREPA (O83748) Elongation factor G 1 (EF-G 1) | 30 | 3.3 | 2 | ANKR5_MOUSE (Q9D2J7) Ankyrin repeat domain-containing protein 5 | 28 | 9.7 | 3 | PALI_EMENI (O93956) pH-response regulator protein palI/RIM9 | 28 | 9.7 | 4 | ZBT34_HUMAN (Q8NCN2) Zinc finger and BTB domain-containing prote... | 28 | 9.7 |
---|
>EFG1_TREPA (O83748) Elongation factor G 1 (EF-G 1)| Length = 695 Score = 29.6 bits (65), Expect = 3.3 Identities = 17/54 (31%), Positives = 31/54 (57%) Frame = +2 Query: 89 TESYNGVSESNPTANPSFFSPEYIAPINQCSGDLHLSQQMEREQRQWRGD*PSG 250 +++ N ++ +PT SF PE I Q G+LHL +ER +R+++ + +G Sbjct: 421 SKALNRFTKEDPTFR-SFVDPESNQTIIQGMGELHLDVYIERMRREYKCEVETG 473
>ANKR5_MOUSE (Q9D2J7) Ankyrin repeat domain-containing protein 5| Length = 775 Score = 28.1 bits (61), Expect = 9.7 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -2 Query: 126 VGLDSETPL*LSVLMGF--CCKYV 61 +G+D TPL + + GF CCKY+ Sbjct: 247 IGMDGNTPLHFAAMGGFADCCKYI 270
>PALI_EMENI (O93956) pH-response regulator protein palI/RIM9| Length = 549 Score = 28.1 bits (61), Expect = 9.7 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -2 Query: 321 TPGSPTWPPAT*RVRQRH-HARQPPPLG*SPR 229 TPG P PP RVR ++ R+ PP G +PR Sbjct: 303 TPGPPGPPPPDSRVRDQYSDPRRGPPTGFAPR 334
>ZBT34_HUMAN (Q8NCN2) Zinc finger and BTB domain-containing protein 34| Length = 500 Score = 28.1 bits (61), Expect = 9.7 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +2 Query: 86 NTESYNGVSESNPTANPSFFSPEYIAPINQ--CSGDLHL 196 N ES NGV +S+ ANP SP Y + Q S DL + Sbjct: 144 NPESRNGVKDSSFFANPVEISPPYCSQGRQPTASSDLRM 182 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,955,289 Number of Sequences: 219361 Number of extensions: 878058 Number of successful extensions: 2190 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2190 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)