Clone Name | rbart56f11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MS2_ARATH (Q08891) Male sterility protein 2 | 28 | 7.9 |
---|
>MS2_ARATH (Q08891) Male sterility protein 2| Length = 616 Score = 27.7 bits (60), Expect = 7.9 Identities = 21/56 (37%), Positives = 25/56 (44%) Frame = +1 Query: 82 TSSGLITMANKLTPQHNHNYPGFNHHKKKRESPT*NVHIRGGDPIHRKNNKCSMRV 249 +SS I +NKLT HNH KKR PT GGD N + +RV Sbjct: 8 SSSSSIVASNKLTRLHNHCVWSTVIRDKKRFGPTWCRVGGGGDGGRNSNAERPIRV 63 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,526,514 Number of Sequences: 219361 Number of extensions: 947017 Number of successful extensions: 2237 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2199 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2236 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)