Clone Name | rbart56e06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SLUG_XENLA (Q91924) Snail protein homolog Slug (xSlu protein) | 28 | 6.7 |
---|
>SLUG_XENLA (Q91924) Snail protein homolog Slug (xSlu protein)| Length = 266 Score = 28.1 bits (61), Expect = 6.7 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +2 Query: 44 LQTTYLDSLATRSYKTLIRTCDLFYYETTPARRHQAMHYDAITRKS 181 LQT DS A + K C Y + +H+ +H DA +RKS Sbjct: 111 LQTKLSDSHAIEAEKFQCSLCSKTYSTFSGLAKHKQLHCDAQSRKS 156 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,512,495 Number of Sequences: 219361 Number of extensions: 332506 Number of successful extensions: 729 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 725 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 729 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)