ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart56d06 |
|---|---|
| Clone Library Name | barley_pub |
>RL3L_BOVIN (Q3SZ10) 60S ribosomal protein L3-like| Length = 406 Score = 53.9 bits (128), Expect = 1e-07 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = -1 Query: 177 VHFSRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 VH SR LE LKF+D +SKFG G FQ +EK AF+GP+K Sbjct: 352 VHHSRQALENIELKFIDTTSKFGHGRFQTAQEKRAFMGPQK 392
>RL3L_HUMAN (Q92901) 60S ribosomal protein L3-like| Length = 406 Score = 52.8 bits (125), Expect = 3e-07 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = -1 Query: 177 VHFSRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 VH SR +E LKF+D +SKFG G FQ +EK AF+GP+K Sbjct: 352 VHHSRQAVENIELKFIDTTSKFGHGRFQTAQEKRAFMGPQK 392
>RL3_BOVIN (P39872) 60S ribosomal protein L3| Length = 402 Score = 50.4 bits (119), Expect = 1e-06 Identities = 24/41 (58%), Positives = 28/41 (68%) Frame = -1 Query: 177 VHFSRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 V R LE+ LKF+D +SKFG G FQ VEEK AF+GP K Sbjct: 352 VQTKRRALEKIDLKFIDTTSKFGHGRFQTVEEKKAFMGPLK 392
>RL3_RAT (P21531) 60S ribosomal protein L3 (L4)| Length = 402 Score = 49.3 bits (116), Expect = 3e-06 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = -1 Query: 177 VHFSRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 V R LE+ LKF+D +SKFG G FQ +EEK AF+GP K Sbjct: 352 VQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 392
>RL3_MOUSE (P27659) 60S ribosomal protein L3 (J1 protein)| Length = 402 Score = 49.3 bits (116), Expect = 3e-06 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = -1 Query: 177 VHFSRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 V R LE+ LKF+D +SKFG G FQ +EEK AF+GP K Sbjct: 352 VQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 392
>RL3_MACFA (Q4R5Q0) 60S ribosomal protein L3| Length = 402 Score = 49.3 bits (116), Expect = 3e-06 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = -1 Query: 177 VHFSRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 V R LE+ LKF+D +SKFG G FQ +EEK AF+GP K Sbjct: 352 VQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 392
>RL3_HUMAN (P39023) 60S ribosomal protein L3 (HIV-1 TAR RNA-binding protein B)| (TARBP-B) Length = 402 Score = 49.3 bits (116), Expect = 3e-06 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = -1 Query: 177 VHFSRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 V R LE+ LKF+D +SKFG G FQ +EEK AF+GP K Sbjct: 352 VQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 392
>RL3_DROME (O16797) 60S ribosomal protein L3| Length = 415 Score = 47.4 bits (111), Expect = 1e-05 Identities = 23/40 (57%), Positives = 26/40 (65%) Frame = -1 Query: 174 HFSRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 H RS LEQ LKF+D SSK G G FQ +K AF+GP K Sbjct: 353 HTKRSALEQIKLKFIDTSSKMGHGRFQTPADKLAFMGPLK 392
>RL3_YEAST (P14126) 60S ribosomal protein L3 (YL1) (RP1) (Maintenance of| killer protein 8) (Trichodermin resistance protein) Length = 386 Score = 45.1 bits (105), Expect = 5e-05 Identities = 21/38 (55%), Positives = 27/38 (71%) Frame = -1 Query: 168 SRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 SR LE+ SLK++D +SKFG G FQ EK+AF+G K Sbjct: 346 SRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLK 383
>RL3_KLULA (Q6CJR7) 60S ribosomal protein L3| Length = 387 Score = 44.7 bits (104), Expect = 7e-05 Identities = 21/38 (55%), Positives = 27/38 (71%) Frame = -1 Query: 168 SRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 SR LE+ +LK++D +SKFG G FQ EK+AFLG K Sbjct: 347 SRKALEEVTLKWIDTASKFGKGRFQTPAEKHAFLGTLK 384
>RL3_ASPFU (Q8NKF4) 60S ribosomal protein L3 (Allergen Asp f 23)| Length = 392 Score = 44.3 bits (103), Expect = 9e-05 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = -1 Query: 168 SRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 SR E+ LK++D SSKFG G+FQ EEK AF+G K Sbjct: 348 SRRATEKVELKWIDTSSKFGHGAFQTPEEKRAFMGTLK 385
>RL3_ORYSA (P35684) 60S ribosomal protein L3| Length = 388 Score = 43.9 bits (102), Expect = 1e-04 Identities = 21/38 (55%), Positives = 24/38 (63%) Frame = -1 Query: 168 SRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 SR LE+ LKF+D SSKFG G FQ +EK F G K Sbjct: 350 SRLALEEIKLKFIDTSSKFGHGRFQTTDEKQRFFGKLK 387
>RL3_ASHGO (Q759R7) 60S ribosomal protein L3| Length = 388 Score = 43.5 bits (101), Expect = 2e-04 Identities = 20/38 (52%), Positives = 27/38 (71%) Frame = -1 Query: 168 SRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 SR LE+ +LK++D +SKFG G FQ EK+AF+G K Sbjct: 348 SRRALEEVNLKWIDTASKFGKGRFQTPAEKHAFMGTLK 385
>RL3_NEUCR (P59671) 60S ribosomal protein L3| Length = 392 Score = 43.1 bits (100), Expect = 2e-04 Identities = 21/41 (51%), Positives = 26/41 (63%) Frame = -1 Query: 177 VHFSRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 VH SR LE+ LK++D SS+FG G+FQ EK F G K Sbjct: 345 VHTSRKALEKVELKWIDTSSEFGHGAFQTPAEKKQFQGTLK 385
>RL3_CANGA (Q6FTJ2) 60S ribosomal protein L3| Length = 387 Score = 42.7 bits (99), Expect = 3e-04 Identities = 19/38 (50%), Positives = 27/38 (71%) Frame = -1 Query: 168 SRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 SR +E+ +LK++D +SKFG G FQ EK+AF+G K Sbjct: 347 SRKAVEEVTLKWIDTASKFGKGRFQTPAEKHAFMGTLK 384
>RL3B_SCHPO (P36584) 60S ribosomal protein L3-B| Length = 387 Score = 42.0 bits (97), Expect = 5e-04 Identities = 21/40 (52%), Positives = 24/40 (60%) Frame = -1 Query: 174 HFSRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 H SR LE SLK++D +SKFG G FQ E FLG K Sbjct: 344 HTSRKALEPVSLKWIDTASKFGHGRFQTPAEAKQFLGTLK 383
>RL3A_SCHPO (P40372) 60S ribosomal protein L3-A| Length = 387 Score = 42.0 bits (97), Expect = 5e-04 Identities = 21/40 (52%), Positives = 24/40 (60%) Frame = -1 Query: 174 HFSRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 H SR LE SLK++D +SKFG G FQ E FLG K Sbjct: 344 HTSRKALEPVSLKWIDTASKFGHGRFQTPAEAKQFLGTLK 383
>RL3_DICDI (P34113) 60S ribosomal protein L3| Length = 397 Score = 42.0 bits (97), Expect = 5e-04 Identities = 19/40 (47%), Positives = 27/40 (67%) Frame = -1 Query: 165 RSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRKIKS 46 R+ LE+ +LKF+D SSKFG G Q E+K + G +K +S Sbjct: 355 RAALEKITLKFIDTSSKFGHGLHQTAEDKTKYFGVKKSRS 394
>RL3_DEBHA (Q6BXM5) 60S ribosomal protein L3| Length = 389 Score = 42.0 bits (97), Expect = 5e-04 Identities = 21/41 (51%), Positives = 26/41 (63%) Frame = -1 Query: 177 VHFSRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 V SR E +LK++D +SKFG G FQ EK+AFLG K Sbjct: 344 VDTSRRATENVNLKWIDTASKFGKGRFQTPAEKHAFLGTLK 384
>RL3_ENCCU (Q8SQI3) 60S ribosomal protein L3| Length = 383 Score = 38.9 bits (89), Expect = 0.004 Identities = 19/33 (57%), Positives = 21/33 (63%) Frame = -1 Query: 153 EQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 E+ +KFVD SSK G G FQ EK AF G RK Sbjct: 343 EELVIKFVDTSSKIGHGRFQTSAEKKAFYGARK 375
>RL3_TOXCA (P49149) 60S ribosomal protein L3| Length = 401 Score = 38.9 bits (89), Expect = 0.004 Identities = 20/41 (48%), Positives = 25/41 (60%) Frame = -1 Query: 177 VHFSRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 V R E+ +LK++D SSKFG G FQ EK AF+G K Sbjct: 349 VQTKRFAHEKINLKWIDTSSKFGHGRFQTHAEKRAFMGKLK 389
>RL3_CAEEL (P50880) 60S ribosomal protein L3| Length = 401 Score = 36.6 bits (83), Expect = 0.019 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = -1 Query: 153 EQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 E+ +LK++D SSK G G FQ EK AF+G K Sbjct: 358 EKINLKWIDTSSKTGHGRFQTTAEKRAFMGKLK 390
>RL3_CAEBR (Q9NBK4) 60S ribosomal protein L3| Length = 401 Score = 36.6 bits (83), Expect = 0.019 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = -1 Query: 153 EQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRK 55 E+ +LK++D SSK G G FQ EK AF+G K Sbjct: 358 EKINLKWIDTSSKTGHGRFQTTAEKRAFMGKLK 390
>RL3B_ARATH (P22738) 60S ribosomal protein L3| Length = 389 Score = 34.7 bits (78), Expect = 0.072 Identities = 19/41 (46%), Positives = 25/41 (60%) Frame = -1 Query: 168 SRSPLEQTSLKFVDPSSKFGPGSFQPVEEKNAFLGPRKIKS 46 SR +E+ LKF+D +S G G FQ +EK F G R IK+ Sbjct: 350 SRLAMEEIKLKFIDAASNGGHGRFQTSQEKAKFYG-RTIKA 389
>SIG10_HUMAN (Q96LC7) Sialic acid-binding Ig-like lectin 10 precursor| (Siglec-10) (Siglec-like protein 2) Length = 697 Score = 29.6 bits (65), Expect = 2.3 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = -3 Query: 166 PLPPGADKPQVCRPQ-LQVRSRIFPASRGEERFPWSPQDQERLN--VLLFRGCLP 11 PLPPGA P+ + Q Q + FP + + P S + QE L+ L F G P Sbjct: 623 PLPPGAPSPESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGVRP 677
>YGIDB_PSEPU (P0A150) Hypothetical protein in gidB 3' region| Length = 263 Score = 29.6 bits (65), Expect = 2.3 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 46 ALDLAGTKESVLLLDWLERSGTELGAGVDKLE 141 A LA TK VLL+D + +G+GVDK E Sbjct: 24 AASLAATKRRVLLIDLDPQGNATMGSGVDKHE 55
>Y002_PSEPK (P0A149) Hypothetical protein PP0002| Length = 263 Score = 29.6 bits (65), Expect = 2.3 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 46 ALDLAGTKESVLLLDWLERSGTELGAGVDKLE 141 A LA TK VLL+D + +G+GVDK E Sbjct: 24 AASLAATKRRVLLIDLDPQGNATMGSGVDKHE 55
>NCOR2_HUMAN (Q9Y618) Nuclear receptor corepressor 2 (N-CoR2) (Silencing mediator| of retinoic acid and thyroid hormone receptor) (SMRT) (SMRTe) (Thyroid-, retinoic-acid-receptor-associated corepressor) (T3 receptor-associating factor) (TRAC) (CTG repeat p Length = 2517 Score = 28.1 bits (61), Expect = 6.8 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -3 Query: 166 PLPPGADKPQVCRPQLQVRSRIFPASRGEERFPWSPQDQE 47 P PP PQ +P+ + + RG+ R P P D+E Sbjct: 994 PAPPAPPPPQNLQPESDAPQQPGSSPRGKSRSPAPPADKE 1033
>HNRL1_MOUSE (Q8VDM6) Heterogeneous nuclear ribonucleoprotein U-like protein 1| Length = 859 Score = 27.7 bits (60), Expect = 8.8 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 Query: 163 LPPGADKPQVCRPQLQVRSRIFPASRGEERF 71 LPP A + + RPQ Q R R F +RG F Sbjct: 155 LPPEASQLKTDRPQFQNRKRPFEENRGRGYF 185 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,031,530 Number of Sequences: 219361 Number of extensions: 526663 Number of successful extensions: 1465 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 1447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1465 length of database: 80,573,946 effective HSP length: 34 effective length of database: 73,115,672 effective search space used: 1754776128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)
