Clone Name | rbart56c07 |
---|---|
Clone Library Name | barley_pub |
>LAS17_YEAST (Q12446) Proline-rich protein LAS17| Length = 633 Score = 36.6 bits (83), Expect = 0.015 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = +1 Query: 169 RRCRQAHTPRRDGRFENY---YSVRGRDTIHVRAHQQPPPPPHDRSTMNSDKIPSMA 330 ++ + H PR + +N Y+ DTI H+ PPPPP T +SD+ S + Sbjct: 148 QKSQVVHGPRGESLIDNQRKRYNYEDVDTIPTTKHKAPPPPPPTAETFDSDQTSSFS 204
>INADL_MOUSE (Q63ZW7) InaD-like protein (Inadl protein) (Pals1-associated tight| junction protein) (Protein associated to tight junctions) (Channel-interacting PDZ domain-containing protein) Length = 1834 Score = 31.6 bits (70), Expect = 0.48 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 250 HVRAHQQPPPPPHDRSTMNSDKIPSMAAQTDW 345 H+RA + PPPPH R + + + A T W Sbjct: 882 HLRAMESNPPPPHIREAAPASPVLELQAGTQW 913
>RL4_HALMA (P12735) 50S ribosomal protein L4P (Hmal4) (Hl6)| Length = 246 Score = 28.5 bits (62), Expect = 4.1 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 181 QAHTPRRDGRFENY-YSVRGRDTIHVRAHQQPPPPPHDRSTMNSDKIPSMAAQT 339 QAH P++DGR +V+GR AH PP DRS +DK +A ++ Sbjct: 67 QAHVPKQDGRARRVPQAVKGRS-----AH--PPKTEKDRSLDLNDKERQLAVRS 113
>RS5_HALSA (Q9HPB4) 30S ribosomal protein S5P| Length = 212 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -3 Query: 383 DQGDPLQEPRLVDQSVWAAMDGILSLFIVDRSCGGG 276 D G PL+EP +VDQ + D +L + +V R G Sbjct: 30 DTGLPLKEPEIVDQLLPGLDDEVLDINMVQRMTDSG 65
>NONO_PONPY (Q5RFL9) Non-POU domain-containing octamer-binding protein (NonO| protein) Length = 471 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 178 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 285 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>NONO_HUMAN (Q15233) Non-POU domain-containing octamer-binding protein (NonO| protein) (54 kDa nuclear RNA- and DNA-binding protein) (p54(nrb)) (p54nrb) (55 kDa nuclear protein) (NMT55) (DNA-binding p52/p100 complex, 52 kDa subunit) Length = 471 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 178 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 285 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>FUR_STAEP (P0C0P3) Ferric uptake regulation protein (Ferric uptake regulator)| Length = 138 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +2 Query: 170 DAAGRHTHRGETADLRTITACAAETRFTYARTSNHHHHHMI 292 D R+ H + + T E +F A T NHHHHH I Sbjct: 54 DTVYRNLHLFKDLGIIESTELEGEMKFRIACT-NHHHHHFI 93
>HUNB_DROOR (O62537) Protein hunchback| Length = 767 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +2 Query: 239 ETRFTYARTSNHHHHHMIGRR*TAIRFHP-WPPRLIGPL 352 + F A+ +HHHHH++G F+P PP L P+ Sbjct: 109 QQHFQAAQQQHHHHHHLMG------GFNPLTPPGLPNPM 141
>HUNB_DROME (P05084) Protein hunchback| Length = 758 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +2 Query: 239 ETRFTYARTSNHHHHHMIGRR*TAIRFHP-WPPRLIGPL 352 + F A+ +HHHHH++G F+P PP L P+ Sbjct: 107 QQHFQAAQQQHHHHHHLMG------GFNPLTPPGLPNPM 139
>KP58_DROME (Q9VPC0) Serine/threonine-protein kinase PITSLRE (EC 2.7.11.22)| (Cell division cycle 2-like) Length = 952 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +2 Query: 251 TYARTSNHHHHHMIGRR*TAIRFHPWPPRLIGPLAAALEGDRP 379 +YA HHH H+ G R +H +P G + + GD P Sbjct: 135 SYAAHHYHHHQHLSGARAAPREYHSYPS---GYHSGSRHGDYP 174
>HYIN1_AGRVI (Q04557) Indoleacetamide hydrolase (EC 3.5.1.-) (IAH)| (Indole-3-acetamide hydrolase) Length = 462 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 169 RRCRQAHTPRRDGRFENYYSVRGRDTI 249 RR + + PR +ENYYS G D + Sbjct: 346 RRALRCYKPRLKATYENYYSSNGLDAV 372
>NO75_LUPLU (Q06841) Early nodulin 75 protein (N-75) (NGM-75) (Fragment)| Length = 434 Score = 28.1 bits (61), Expect = 5.3 Identities = 10/23 (43%), Positives = 17/23 (73%), Gaps = 3/23 (13%) Frame = +1 Query: 247 IHVRAHQQPP---PPPHDRSTMN 306 +H +H++PP PPPH++S M+ Sbjct: 267 VHPPSHEKPPFVYPPPHEKSPMH 289
>HUNB_DROYA (O62541) Protein hunchback| Length = 759 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +2 Query: 239 ETRFTYARTSNHHHHHMIGRR*TAIRFHP-WPPRLIGPL 352 + F A+ +HHHHH++G F+P PP L P+ Sbjct: 108 QQHFQAAQQQHHHHHHLMG------GFNPLTPPGLPNPM 140
>HUNB_DROSE (O62538) Protein hunchback| Length = 757 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +2 Query: 239 ETRFTYARTSNHHHHHMIGRR*TAIRFHP-WPPRLIGPL 352 + F A+ +HHHHH++G F+P PP L P+ Sbjct: 106 QQHFQAAQQQHHHHHHLMG------GFNPLTPPGLPNPM 138
>ZURR_LISMO (P0A3E6) Transcriptional regulator ZurR (Zinc uptake regulator)| Length = 141 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 224 TACAAETRFTYARTSNHHHHHMI 292 T + E F A T HHHHH I Sbjct: 74 TDLSGERNFRLACTHEHHHHHFI 96
>ZURR_LISIN (P0A3E7) Transcriptional regulator ZurR (Zinc uptake regulator)| Length = 141 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 224 TACAAETRFTYARTSNHHHHHMI 292 T + E F A T HHHHH I Sbjct: 74 TDLSGERNFRLACTHEHHHHHFI 96
>BRPF1_HUMAN (P55201) Peregrin (Bromodomain and PHD finger-containing protein 1)| (BR140 protein) Length = 1214 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +2 Query: 260 RTSNHHHHHMIGRR*TAIRFHPWPPRLIGPLAAALEGDRPD 382 + SNHHHHH + T P+L + LE D PD Sbjct: 158 KDSNHHHHHNVSASTT--------PKLPEVVYRELEQDTPD 190
>AGLU_SPIOL (O04893) Alpha-glucosidase precursor (EC 3.2.1.20) (Maltase)| Length = 903 Score = 27.7 bits (60), Expect = 6.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 262 HQQPPPPPHDRSTM 303 HQ PPPPPH S++ Sbjct: 109 HQPPPPPPHSLSSL 122
>CYTSA_FUGRU (Q2KN94) Cytospin-A| Length = 1118 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 164 FKSASFSQYSTCCTTFPTFCIVPVPRTPFNPA 69 F SAS S + PT P+PRTP +P+ Sbjct: 837 FDSASQGPPSNGASVTPTVSAAPLPRTPLSPS 868
>FUR_STAES (P0C0P4) Ferric uptake regulation protein (Ferric uptake regulator)| Length = 139 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +2 Query: 170 DAAGRHTHRGETADLRTITACAAETRFTYARTSNHHHHHMI 292 D R+ H + + T E +F A T NHHHHH I Sbjct: 54 DTVYRNLHLFKDLGIIESTELDGEMKFRIACT-NHHHHHFI 93
>FUR_STAEQ (Q5HNZ4) Ferric uptake regulation protein (Ferric uptake regulator)| Length = 139 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +2 Query: 170 DAAGRHTHRGETADLRTITACAAETRFTYARTSNHHHHHMI 292 D R+ H + + T E +F A T NHHHHH I Sbjct: 54 DTVYRNLHLFKDLGIIESTELDGEMKFRIACT-NHHHHHFI 93
>CYTSA_TETNG (Q2KN95) Cytospin-A| Length = 1113 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 164 FKSASFSQYSTCCTTFPTFCIVPVPRTPFNPA 69 F SAS S+ + PT P+PRTP +P+ Sbjct: 832 FDSASQGPPSSGASVTPTASAAPLPRTPLSPS 863
>CD2L7_CAEEL (P46551) Putative cell division cycle 2-related protein kinase 7| (EC 2.7.11.22) Length = 730 Score = 24.3 bits (51), Expect(2) = 8.5 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +2 Query: 167 GDAAGRHTHRGETADLRTITACAAETRFTYARTSNHHHHH 286 G + H+ R T+ R T + T + +++HHHHH Sbjct: 644 GSSGSGHSIRA-TSHPRAPTQPSTTTTKSNGSSNHHHHHH 682 Score = 21.6 bits (44), Expect(2) = 8.5 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 Query: 262 HQQPPPPPHDRSTMNS 309 H PPPPP +++ S Sbjct: 697 HAPPPPPPPTQASSTS 712
>NLK_MOUSE (O54949) Serine/threonine kinase NLK (EC 2.7.11.24) (Nemo-like| kinase) Length = 515 Score = 23.1 bits (48), Expect(2) = 8.7 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 233 AAETRFTYARTSNHHHHH 286 AA T A + HHHHH Sbjct: 2 AAYNGGTSAAAAGHHHHH 19 Score = 22.7 bits (47), Expect(2) = 8.7 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 269 NHHHHHMIGRR*TAIRFHPWPPRLIGPLAAA 361 +HHHHH+ + H P + P +AA Sbjct: 17 HHHHHHLPHLPPPHLHHHHHPQHHLHPGSAA 47
>NLK_HUMAN (Q9UBE8) Serine/threonine kinase NLK (EC 2.7.11.24) (Nemo-like| kinase) (LAK1 protein) Length = 515 Score = 23.1 bits (48), Expect(2) = 8.7 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 233 AAETRFTYARTSNHHHHH 286 AA T A + HHHHH Sbjct: 2 AAYNGGTSAAAAGHHHHH 19 Score = 22.7 bits (47), Expect(2) = 8.7 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 269 NHHHHHMIGRR*TAIRFHPWPPRLIGPLAAA 361 +HHHHH+ + H P + P +AA Sbjct: 17 HHHHHHLPHLPPPHLHHHHHPQHHLHPGSAA 47
>NRIP1_MOUSE (Q8CBD1) Nuclear receptor-interacting protein 1 (Nuclear factor| RIP140) (Receptor-interacting protein 140) Length = 1161 Score = 27.3 bits (59), Expect = 9.1 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = -1 Query: 247 SCLGRARCNSSQI-CRLSSVCVPAGSVACSSLRVSVSIVPAVLLSLPFALYQYHARHLIQ 71 SC R + +S + R S P SVACS L A+LLS L QY H ++ Sbjct: 236 SCAARLQAVASMVEKRASPAASPKPSVACSQL--------ALLLSSEAHLQQYSREHALK 287
>RN139_MOUSE (Q7TMV1) RING finger protein 139| Length = 668 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = -3 Query: 377 GDPLQEPRLVDQSVWAAMDGIL---SLFIVD 294 G P Q+ R+ Q VWAA++ L L+I+D Sbjct: 5 GPPQQQVRMAQQQVWAALEVALRVPCLYIID 35
>ZO3_CANFA (O62683) Tight junction protein ZO-3 (Zonula occludens 3 protein)| (Zona occludens 3 protein) (Tight junction protein 3) Length = 898 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +1 Query: 202 DGRFENYYSVRGRDTIHVRAHQQPPPPPHDRSTMNSD 312 D F + S G + PPPPPH + +++SD Sbjct: 281 DSSFLDDISALGSELSQAVPSHVPPPPPHAQRSLDSD 317 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,322,468 Number of Sequences: 219361 Number of extensions: 1164857 Number of successful extensions: 5364 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 4161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4938 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)