ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart56a10 |
|---|---|
| Clone Library Name | barley_pub |
>KIF1C_MOUSE (O35071) Kinesin-like protein KIF1C| Length = 1100 Score = 32.7 bits (73), Expect = 0.54 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = -2 Query: 256 RVPEEPHRLHRSRLHTQTGIQHAVGDVSQRPEPHPRRSPLHRG-PAAHLPIP 104 R P P R HRSR ++ G + G S +PEP R H G P P P Sbjct: 1016 RRPPSPRRPHRSRRNSLDGGSRSRGGGSTQPEPQHLRPQKHNGYPQQPQPSP 1067
>XYLT_ARATH (Q9LDH0) Beta-(1,2)-xylosyltransferase (EC 2.4.2.38)| Length = 534 Score = 32.3 bits (72), Expect = 0.71 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 462 VNSCDVLVGVHGAGLTNMVFLPRNGTVLQIV 370 + V++G HGAGLT++V N T+ +I+ Sbjct: 456 IQDASVIIGAHGAGLTHIVSATPNTTIFEII 486
>SFPQ_MOUSE (Q8VIJ6) Splicing factor, proline- and glutamine-rich| (Polypyrimidine tract-binding protein-associated splicing factor) (PTB-associated splicing factor) (PSF) (DNA-binding p52/p100 complex, 100 kDa subunit) Length = 699 Score = 30.8 bits (68), Expect = 2.1 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Frame = +1 Query: 301 PKTHGSHGL-AVGGPGRPLHLA---PRDDLQHRAVAREEHHVGEP 423 PK G G+ A GG +P H PR QH A ++HH G P Sbjct: 208 PKPGGGPGMGAPGGHPKPPHRGGGEPRGGRQHHAPYHQQHHQGPP 252
>RS9_LISMO (Q8Y459) 30S ribosomal protein S9| Length = 130 Score = 30.4 bits (67), Expect = 2.7 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = -3 Query: 468 ETVNSCDVLVGVHGAGLTNMVFLPRNG---TVLQIVP 367 ET+ + DVLV VHG G T R+G +LQ+ P Sbjct: 56 ETLGNYDVLVNVHGGGYTGQAGAIRHGVARALLQVAP 92
>RS9_LISMF (Q71WI2) 30S ribosomal protein S9| Length = 130 Score = 30.4 bits (67), Expect = 2.7 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = -3 Query: 468 ETVNSCDVLVGVHGAGLTNMVFLPRNG---TVLQIVP 367 ET+ + DVLV VHG G T R+G +LQ+ P Sbjct: 56 ETLGNYDVLVNVHGGGYTGQAGAIRHGVARALLQVAP 92
>RS9_LISIN (Q927P3) 30S ribosomal protein S9| Length = 130 Score = 30.4 bits (67), Expect = 2.7 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = -3 Query: 468 ETVNSCDVLVGVHGAGLTNMVFLPRNG---TVLQIVP 367 ET+ + DVLV VHG G T R+G +LQ+ P Sbjct: 56 ETLGNYDVLVNVHGGGYTGQAGAIRHGVARALLQVAP 92
>YKC2_CAEEL (P41993) Hypothetical protein B0280.2| Length = 627 Score = 30.0 bits (66), Expect = 3.5 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +2 Query: 329 P*EVQAGHFIS-PQGTICSTVPLRGRNTML-VSPAPCTPTNTSHEFTVSANLPRSRT 493 P E++ G+++S P T CS P+ V PAP PT+ ++A+ P S T Sbjct: 374 PFELEVGNYVSFPNHTHCSEKPIAEAPLRPPVRPAPIVPTSAGLCLVLAASFPTSST 430
>CS016_HUMAN (Q8ND99) Protein C19orf16| Length = 567 Score = 30.0 bits (66), Expect = 3.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 369 PWGEMKWPAWTSYGEPVAP 313 PWGEMK P W G P P Sbjct: 424 PWGEMKEPPWDPKGPPKVP 442
>SFPQ_HUMAN (P23246) Splicing factor, proline- and glutamine-rich| (Polypyrimidine tract-binding protein-associated splicing factor) (PTB-associated splicing factor) (PSF) (DNA-binding p52/p100 complex, 100 kDa subunit) (100-kDa DNA-pairing protein) (hPOMp Length = 707 Score = 29.3 bits (64), Expect = 6.0 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +1 Query: 301 PKTHGSHGLAV-GGPGRPLHLA---PRDDLQHRAVAREEHHVGEP 423 PK G GL+ GG +P H PR QH ++HH G P Sbjct: 216 PKPGGGPGLSTPGGHPKPPHRGGGEPRGGRQHHPPYHQQHHQGPP 260
>RS9_BACST (P07842) 30S ribosomal protein S9 (BS10)| Length = 129 Score = 28.9 bits (63), Expect = 7.8 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = -3 Query: 468 ETVNSCDVLVGVHGAGLTNMVFLPRNG---TVLQIVP 367 ET+ S DVLV VHG G R+G +LQ+ P Sbjct: 55 ETLGSYDVLVNVHGGGFAGQAGAIRHGIARALLQVDP 91
>CP304_DROME (Q9VG17) Probable cytochrome P450 304a1 (EC 1.14.-.-) (CYPCCCIVA1)| Length = 510 Score = 28.9 bits (63), Expect = 7.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 390 GTVLQIVPWGEMKWPAWTSYGE 325 G +L I+PW WP W+ Y + Sbjct: 232 GKMLSIIPWIRHIWPEWSGYNK 253
>KIF1C_RAT (O35787) Kinesin-like protein KIF1C (Kinesin-like protein KIF1D)| Length = 1097 Score = 28.9 bits (63), Expect = 7.8 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = -2 Query: 256 RVPEEPHRLHRSRLHTQTGIQHAVGDVSQRPEPHPRRSPLHRG-PAAHLPIP 104 R P P R HR R ++ G + G S +PEP R H P P P Sbjct: 1013 RRPPSPRRPHRPRRNSLDGGSRSRGGGSTQPEPQHLRPQKHNSYPQQPQPYP 1064
>PLSX_RALSO (Q8Y0J5) Fatty acid/phospholipid synthesis protein plsX| Length = 354 Score = 28.9 bits (63), Expect = 7.8 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +1 Query: 313 GSHGLAVGGPGRPLHLAPRDDLQHRAVAREEHHVGEPRTMHAHQHVARVH 462 G HG+AV P LA +D++ V + + E + +HA H +R+H Sbjct: 12 GDHGVAVTIPAAIQFLAAHEDVEMLLVGQPDVIAAELKRLHATAH-SRIH 60
>YYY1_HUMAN (P49646) Very very hypothetical protein RMSA-1| Length = 418 Score = 28.9 bits (63), Expect = 7.8 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = -3 Query: 177 FLNGQNLTLDVHRFTGV--LQHIYQSLLPSHN*VDYISVFLSFFFFQMEHMDFIPR 16 FL LT RFT + L +++Q + P V YIS F F+ + MD +PR Sbjct: 60 FLLRFGLTTFKERFTSLILLNNMHQMIFPM---VKYISKLCIFHFWHLVLMDLVPR 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,879,080 Number of Sequences: 219361 Number of extensions: 1429127 Number of successful extensions: 4964 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 4689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4956 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
