Clone Name | rbart56a07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ERG24_FUSSO (Q01447) Delta(14)-sterol reductase (EC 1.3.1.70) (C... | 32 | 0.40 | 2 | SYFB_CHLCV (Q824J8) Phenylalanyl-tRNA synthetase beta chain (EC ... | 28 | 4.5 | 3 | TRHDE_HUMAN (Q9UKU6) Thyrotropin-releasing hormone degrading ect... | 28 | 7.6 | 4 | WDR12_RAT (P61480) WD-repeat protein 12 | 27 | 10.0 | 5 | WDR12_MOUSE (Q9JJA4) WD-repeat protein 12 (YTM1 homolog) | 27 | 10.0 |
---|
>ERG24_FUSSO (Q01447) Delta(14)-sterol reductase (EC 1.3.1.70) (C-14 sterol| reductase) (Sterol C14-reductase) Length = 485 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -2 Query: 112 LCGEVRQSEWFVCRP-VFPWVIFFSPWC*SRL*SYG 8 L GEV EW RP + W+IF WC + +YG Sbjct: 217 LIGEVDLKEWLELRPGMMGWIIFNCSWCAQQYRNYG 252
>SYFB_CHLCV (Q824J8) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 793 Score = 28.5 bits (62), Expect = 4.5 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 7/62 (11%) Frame = +1 Query: 49 KLPMGRLDDTQTTLTDVPHHTD--PESTVLYTDSFIRCILEPNL-----IIGLGCKLHFL 207 +L L T+ L + P +T + L D+FI C L PNL ++GL ++ ++ Sbjct: 127 ELGFAHLQTTERGLFEFPENTPLGESACALLADTFIECSLTPNLGHCASLLGLAREITYV 186 Query: 208 YN 213 N Sbjct: 187 TN 188
>TRHDE_HUMAN (Q9UKU6) Thyrotropin-releasing hormone degrading ectoenzyme (EC| 3.4.19.6) (TRH-degrading ectoenzyme) (TRH-DE) (TRH-specific aminopeptidase) (Thyroliberinase) (Pyroglutamyl-peptidase II) (PAP-II) Length = 1024 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 2 VASVASKSTLAPGREKNYPWEDWT 73 VAS + S P E+ PWE WT Sbjct: 114 VASPGTTSAQPPSEEEREPWEPWT 137
>WDR12_RAT (P61480) WD-repeat protein 12| Length = 423 Score = 27.3 bits (59), Expect = 10.0 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 31 STRERKKLPMGRLDDTQTTLTDVPHHTDPESTVLYTDS 144 + R RKK +L T+T L + HT+ S+VL++D+ Sbjct: 231 TNRPRKKQKTEQLGLTRTPLVTLSGHTEAISSVLWSDA 268
>WDR12_MOUSE (Q9JJA4) WD-repeat protein 12 (YTM1 homolog)| Length = 423 Score = 27.3 bits (59), Expect = 10.0 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 31 STRERKKLPMGRLDDTQTTLTDVPHHTDPESTVLYTDS 144 + R RKK +L T+T L + HT+ S+VL++D+ Sbjct: 231 TNRPRKKQKTEQLGLTRTPLVTLSGHTEAISSVLWSDA 268 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,840,587 Number of Sequences: 219361 Number of extensions: 711231 Number of successful extensions: 1546 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1546 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)