ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart56a01 |
|---|---|
| Clone Library Name | barley_pub |
>XTH8_ORYSA (Q76BW5) Xyloglucan endotransglycosylase/hydrolase protein 8| precursor (EC 2.4.1.207) (End-xyloglucan transferase) (OsXTH8) (OsXRT5) Length = 290 Score = 70.9 bits (172), Expect = 8e-13 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 274 ELSTVAWAERNCLSYNYCADGWRFPKGFPGECGRK 170 EL TVAWAERN +SYNYCADGWRFP+GFP EC RK Sbjct: 256 ELGTVAWAERNYMSYNYCADGWRFPQGFPAECYRK 290
>XTH22_ARATH (Q38857) Xyloglucan endotransglucosylase/hydrolase protein 22| precursor (EC 2.4.1.207) (At-XTH22) (XTH-22) (Touch protein 4) Length = 284 Score = 42.4 bits (98), Expect = 3e-04 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -3 Query: 256 WAERNCLSYNYCADGWRFPKGFPGEC 179 W +RN + YNYC D RFP+G P EC Sbjct: 256 WVQRNYMIYNYCTDAKRFPQGLPKEC 281
>XTH20_ARATH (Q9FI31) Probable xyloglucan endotransglucosylase/hydrolase protein| 20 precursor (EC 2.4.1.207) (At-XTH20) (XTH-20) Length = 282 Score = 41.2 bits (95), Expect = 7e-04 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = -3 Query: 262 VAWAERNCLSYNYCADGWRFPKGFPGEC 179 V WA+R + YNYC D RFP+G P EC Sbjct: 254 VKWAQRKYMVYNYCTDKKRFPQGAPPEC 281
>XTH23_ARATH (Q38910) Probable xyloglucan endotransglucosylase/hydrolase protein| 23 precursor (EC 2.4.1.207) (At-XTH23) (XTH-23) Length = 286 Score = 40.4 bits (93), Expect = 0.001 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -3 Query: 256 WAERNCLSYNYCADGWRFPKGFPGEC 179 W + N + YNYC D RFP+G P EC Sbjct: 258 WVQNNYMIYNYCTDAKRFPQGLPREC 283
>XTH12_ARATH (Q9FKL9) Probable xyloglucan endotransglucosylase/hydrolase protein| 12 precursor (EC 2.4.1.207) (At-XTH12) (XTH-12) Length = 285 Score = 40.0 bits (92), Expect = 0.002 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -3 Query: 274 ELSTVAWAERNCLSYNYCADGWRFPKGFPGEC 179 +L + W +++ + YNYC D RFP+G P EC Sbjct: 251 QLGQLKWVQKDYMIYNYCTDFKRFPQGLPTEC 282
>XTH24_ARATH (P24806) Xyloglucan endotransglucosylase/hydrolase protein 24| precursor (EC 2.4.1.207) (At-XTH24) (XTH-24) (Meristem protein 5) (MERI-5 protein) (MERI5 protein) (Endo-xyloglucan transferase) (Xyloglucan endo-1,4-beta-D-glucanase) Length = 269 Score = 39.7 bits (91), Expect = 0.002 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 Query: 256 WAERNCLSYNYCADGWRFPKGFPGEC 179 W ++N + YNYC D RFP+G P EC Sbjct: 240 WVQKNYMIYNYCTDHRRFPQGAPKEC 265
>XTH15_ARATH (Q38911) Probable xyloglucan endotransglucosylase/hydrolase protein| 15 precursor (EC 2.4.1.207) (At-XTH15) (XTH-15) Length = 289 Score = 39.7 bits (91), Expect = 0.002 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 256 WAERNCLSYNYCADGWRFPKGFPGEC 179 W ++ + YNYC+D RFP+GFP EC Sbjct: 259 WVQKYFMIYNYCSDLKRFPRGFPPEC 284
>XTH14_ARATH (Q9ZSU4) Xyloglucan endotransglucosylase/hydrolase protein 14| precursor (EC 2.4.1.207) (At-XTH14) (XTH-14) Length = 287 Score = 39.3 bits (90), Expect = 0.003 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 Query: 256 WAERNCLSYNYCADGWRFPKGFPGEC 179 W +R+ + YNYC D RFP+G P EC Sbjct: 260 WVQRDFMIYNYCTDFKRFPQGLPKEC 285
>BRU1_SOYBN (P35694) Brassinosteroid-regulated protein BRU1 precursor| Length = 283 Score = 38.9 bits (89), Expect = 0.003 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = -3 Query: 256 WAERNCLSYNYCADGWRFPKGFPGECGR 173 W ++ + YNYC+D RFP+G P EC R Sbjct: 256 WVQKYFMIYNYCSDLKRFPQGLPAECKR 283
>XTH16_ARATH (Q8LG58) Probable xyloglucan endotransglucosylase/hydrolase protein| 16 precursor (EC 2.4.1.207) (At-XTH16) (XTH-16) Length = 291 Score = 37.4 bits (85), Expect = 0.010 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -3 Query: 256 WAERNCLSYNYCADGWRFPKGFPGEC 179 W ++ + Y+YC+D RFP+GFP EC Sbjct: 261 WVQKYFMIYDYCSDLKRFPQGFPPEC 286
>XTH25_ARATH (Q38907) Probable xyloglucan endotransglucosylase/hydrolase protein| 25 precursor (EC 2.4.1.207) (At-XTH25) (XTH-25) Length = 284 Score = 37.4 bits (85), Expect = 0.010 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -3 Query: 250 ERNCLSYNYCADGWRFPKGFPGEC 179 +R + YNYC D RFP+GFP EC Sbjct: 259 QRKYMIYNYCTDTKRFPQGFPKEC 282
>XTH13_ARATH (Q9FKL8) Putative xyloglucan endotransglucosylase/hydrolase protein| 13 precursor (EC 2.4.1.207) (At-XTH13) (XTH-13) Length = 284 Score = 36.6 bits (83), Expect = 0.017 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 256 WAERNCLSYNYCADGWRFPKGFPGEC 179 W + + + YNYC D RFP+G P EC Sbjct: 256 WVQDDYMIYNYCTDFKRFPQGLPTEC 281
>XTH21_ARATH (Q9ZV40) Probable xyloglucan endotransglucosylase/hydrolase protein| 21 precursor (EC 2.4.1.207) (At-XTH21) (XTH-21) Length = 305 Score = 35.8 bits (81), Expect = 0.029 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -3 Query: 256 WAERNCLSYNYCADGWRFPKGFPGECGRK 170 W +R + YNYC D RF G P EC K Sbjct: 271 WVQRKFMVYNYCKDKKRFSNGLPVECTAK 299
>XTH17_ARATH (O80803) Probable xyloglucan endotransglucosylase/hydrolase protein| 17 precursor (EC 2.4.1.207) (At-XTH17) (XTH-17) Length = 282 Score = 33.9 bits (76), Expect = 0.11 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 232 YNYCADGWRFPKGFPGEC 179 YNYC D RFP+G P EC Sbjct: 264 YNYCTDKRRFPRGVPAEC 281
>XTH8_ARATH (Q8L9A9) Probable xyloglucan endotransglucosylase/hydrolase protein| 8 precursor (EC 2.4.1.207) (At-XTH8) (XTH-8) Length = 292 Score = 33.9 bits (76), Expect = 0.11 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -3 Query: 259 AWAERNCLSYNYCADGWRFPKGFPGEC 179 AW +RN + Y+YC D RFP P EC Sbjct: 261 AWVQRNLVVYDYCKDSERFPT-LPWEC 286
>XTH19_ARATH (Q9M0D1) Probable xyloglucan endotransglucosylase/hydrolase protein| 19 precursor (EC 2.4.1.207) (At-XTH19) (XTH-19) Length = 277 Score = 33.5 bits (75), Expect = 0.14 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 232 YNYCADGWRFPKGFPGEC 179 YNYC+D RFP+G P EC Sbjct: 259 YNYCSDKKRFPRGVPPEC 276
>XTH18_ARATH (Q9M0D2) Probable xyloglucan endotransglucosylase/hydrolase protein| 18 precursor (EC 2.4.1.207) (At-XTH18) (XTH-18) Length = 282 Score = 32.0 bits (71), Expect = 0.42 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 232 YNYCADGWRFPKGFPGEC 179 YNYC D RFP+G P EC Sbjct: 264 YNYCNDKRRFPRGVPVEC 281
>XTH31_ARATH (P93046) Probable xyloglucan endotransglucosylase/hydrolase protein| 31 precursor (EC 2.4.1.207) (At-XTH31) (XTH-31) (AtXTR8) Length = 293 Score = 30.4 bits (67), Expect = 1.2 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -3 Query: 274 ELSTVAWAERNCLSYNYCAD 215 +++ + WA+RN L YNYC D Sbjct: 263 QMAALTWAQRNFLVYNYCHD 282
>XTH11_ARATH (Q9SMP1) Probable xyloglucan endotransglucosylase/hydrolase protein| 11 precursor (EC 2.4.1.207) (At-XTH11) (XTH-11) Length = 267 Score = 30.4 bits (67), Expect = 1.2 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 253 AERNCLSYNYCADGWRFPKGFPGECG 176 A + L Y+YC+D R+PK P ECG Sbjct: 240 ARKTYLDYDYCSDRQRYPK-VPQECG 264
>XTH_SOYBN (Q39857) Probable xyloglucan endotransglucosylase/hydrolase| precursor (EC 2.4.1.207) (Fragment) Length = 295 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -3 Query: 256 WAERNCLSYNYCADGWRFPKGFPGECGR 173 W + YNYC D R+P P EC R Sbjct: 264 WVRQKYTIYNYCTDTKRYPHISPPECKR 291
>XTH33_ARATH (Q8LC45) Probable xyloglucan endotransglucosylase/hydrolase protein| 33 precursor (EC 2.4.1.207) (At-XTH33) (XTH-33) Length = 310 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 274 ELSTVAWAERNCLSYNYCADGWRFPKGFPGEC 179 +++ + WA R + Y+YC+D R+ K P EC Sbjct: 279 QINAMDWARRKLMFYSYCSDKPRY-KVMPAEC 309
>XTHB_PHAAN (Q8LNZ5) Probable xyloglucan endotransglucosylase/hydrolase protein| B precursor (EC 2.4.1.207) (VaXTH2) Length = 293 Score = 29.3 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 256 WAERNCLSYNYCADGWRFPKGFPGECGR 173 W + YNYC D R+P+ P EC R Sbjct: 263 WVRQKFTIYNYCTDRTRYPQ-LPPECRR 289
>XTH_BRAOB (Q6YDN9) Xyloglucan endotransglucosylase/hydrolase precursor (EC| 2.4.1.207) (BobXET16A) Length = 295 Score = 29.3 bits (64), Expect = 2.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 256 WAERNCLSYNYCADGWRFPKGFPGECGR 173 W YNYC D RFP P EC R Sbjct: 265 WVRMKWTIYNYCTDRTRFPV-MPAECRR 291
>XTH4_ARATH (Q39099) Xyloglucan endotransglucosylase/hydrolase protein 4| precursor (EC 2.4.1.207) (At-XTH4) (XTH-4) Length = 296 Score = 29.3 bits (64), Expect = 2.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 256 WAERNCLSYNYCADGWRFPKGFPGECGR 173 W YNYC D RFP P EC R Sbjct: 266 WVRMKWTIYNYCTDRTRFPV-MPAECKR 292
>XTH5_ARATH (Q9XIW1) Probable xyloglucan endotransglucosylase/hydrolase protein| 5 precursor (EC 2.4.1.207) (At-XTH5) (XTH-5) Length = 293 Score = 28.5 bits (62), Expect = 4.7 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 256 WAERNCLSYNYCADGWRFPKGFPGECGR 173 W + YNYC D RFP P EC R Sbjct: 263 WVRKRYTIYNYCTDRVRFPVP-PPECRR 289
>XTH10_ARATH (Q9ZVK1) Probable xyloglucan endotransglucosylase/hydrolase protein| 10 precursor (EC 2.4.1.207) (At-XTH10) (XTH-10) Length = 299 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -3 Query: 256 WAERNCLSYNYCADGWRFPKGFPGEC 179 W + L Y+YC D RF P EC Sbjct: 269 WVRKYHLIYDYCQDYGRFNNKLPKEC 294 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,548,458 Number of Sequences: 219361 Number of extensions: 494654 Number of successful extensions: 1101 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 1078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1101 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
