Clone Name | rbart55e11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | V17K_BSMV (P04868) 17 kDa protein (Beta-D protein) | 28 | 8.3 | 2 | LYAM1_BOVIN (P98131) L-selectin precursor (Lymph node homing rec... | 28 | 8.3 |
---|
>V17K_BSMV (P04868) 17 kDa protein (Beta-D protein)| Length = 155 Score = 28.1 bits (61), Expect = 8.3 Identities = 13/41 (31%), Positives = 26/41 (63%) Frame = +2 Query: 2 AMLSSVLIFITWLVQYMNTTLPSCSTYYWYIYLSSMHIYDL 124 A+L+S+ I WL+ +++P+ + Y+Y L+S+ IY + Sbjct: 60 AILASLFIIALWLLYIYLSSIPTETGPYFYQDLNSVKIYGI 100
>LYAM1_BOVIN (P98131) L-selectin precursor (Lymph node homing receptor)| (Leukocyte adhesion molecule 1) (LAM-1) (Leukocyte-endothelial cell adhesion molecule 1) (LECAM1) (CD62L antigen) Length = 370 Score = 28.1 bits (61), Expect = 8.3 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 41 VQYMNTTLPSCSTYYW 88 ++Y+N TLP TYYW Sbjct: 73 IEYLNKTLPFSRTYYW 88 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,591,134 Number of Sequences: 219361 Number of extensions: 969440 Number of successful extensions: 1917 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1899 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1917 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)