Clone Name | rbart55e01 |
---|---|
Clone Library Name | barley_pub |
>HMT3_MAIZE (Q9FUM8) Homocysteine S-methyltransferase 3 (EC 2.1.1.10)| (S-methylmethionine:homocysteine methyltransferase 3) (SMM:Hcy S-methyltransferase 3) (ZmHMT-3) Length = 338 Score = 65.5 bits (158), Expect = 6e-11 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 443 EWCKDGAALIGGCCRTTPNTIRAISRSLNQ 354 EWCKDGAALIGGCCRTTPNTIRAI R+LNQ Sbjct: 299 EWCKDGAALIGGCCRTTPNTIRAIHRTLNQ 328
>HMT2_MAIZE (Q9FUM9) Homocysteine S-methyltransferase 2 (EC 2.1.1.10)| (S-methylmethionine:homocysteine methyltransferase 2) (SMM:Hcy S-methyltransferase 2) (ZmHMT-2) Length = 339 Score = 62.4 bits (150), Expect = 5e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 443 EWCKDGAALIGGCCRTTPNTIRAISRSLNQ 354 EWCKDGA LIGGCCRTTPNTIRAI R+LN+ Sbjct: 299 EWCKDGAVLIGGCCRTTPNTIRAIHRTLNK 328
>SMTA_ASTBI (P56707) Selenocysteine methyltransferase (EC 2.1.1.-)| (SECYS-methyltransferase) (SECYS-MT) Length = 338 Score = 48.5 bits (114), Expect = 7e-06 Identities = 18/29 (62%), Positives = 25/29 (86%) Frame = -3 Query: 443 EWCKDGAALIGGCCRTTPNTIRAISRSLN 357 +WC+ GA+L+GGCCRTTP+TIR I + L+ Sbjct: 300 KWCESGASLVGGCCRTTPDTIRGIYKILS 328
>HMT4_MAIZE (Q9FUM7) Homocysteine S-methyltransferase 4 (EC 2.1.1.10)| (S-methylmethionine:homocysteine methyltransferase 4) (SMM:Hcy S-methyltransferase 4) (ZmHMT-4) Length = 342 Score = 47.8 bits (112), Expect = 1e-05 Identities = 19/30 (63%), Positives = 26/30 (86%) Frame = -3 Query: 443 EWCKDGAALIGGCCRTTPNTIRAISRSLNQ 354 EW + GAALIGGCCRT+P T+RAI+R++ + Sbjct: 301 EWRRAGAALIGGCCRTSPATVRAIARAVRE 330
>HMT3_ARATH (Q8LAX0) Homocysteine S-methyltransferase 3 (EC 2.1.1.10)| (S-methylmethionine:homocysteine methyltransferase 3) (SMM:Hcy S-methyltransferase 3) (AtHMT-3) Length = 347 Score = 46.6 bits (109), Expect = 3e-05 Identities = 21/35 (60%), Positives = 26/35 (74%) Frame = -3 Query: 443 EWCKDGAALIGGCCRTTPNTIRAISRSLNQYYPAA 339 +W GA+L GGCCRTTPNTIRAI++ L+ AA Sbjct: 306 KWRDAGASLFGGCCRTTPNTIRAIAKVLSDEPSAA 340
>HMT1_MAIZE (Q9FUN0) Homocysteine S-methyltransferase 1 (EC 2.1.1.10)| (S-methylmethionine:homocysteine methyltransferase 1) (SMM:Hcy S-methyltransferase 1) (ZmHMT-1) Length = 323 Score = 46.2 bits (108), Expect = 4e-05 Identities = 19/27 (70%), Positives = 24/27 (88%) Frame = -3 Query: 440 WCKDGAALIGGCCRTTPNTIRAISRSL 360 W + GA+LIGGCCRTTP+TIRA+S+ L Sbjct: 291 WQEAGASLIGGCCRTTPSTIRAVSKIL 317
>HMT1_ARATH (Q9SDL7) Homocysteine S-methyltransferase 1 (EC 2.1.1.10)| (S-methylmethionine:homocysteine methyltransferase 1) (SMM:Hcy S-methyltransferase 1) (AtHMT-1) Length = 326 Score = 45.1 bits (105), Expect = 8e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -3 Query: 443 EWCKDGAALIGGCCRTTPNTIRAISRSLNQ 354 +W GA LIGGCCRTTP+TI AISR L + Sbjct: 296 KWRDLGAKLIGGCCRTTPSTINAISRDLKR 325
>HMT2_ARATH (Q9M1W4) Homocysteine S-methyltransferase 2 (EC 2.1.1.10)| (S-methylmethionine:homocysteine methyltransferase 2) (SMM:Hcy S-methyltransferase 2) (AtHMT-2) Length = 333 Score = 42.7 bits (99), Expect = 4e-04 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -3 Query: 443 EWCKDGAALIGGCCRTTPNTIRAISRSL 360 +W G +L+GGCCRTTP TIRAI + L Sbjct: 300 KWMDAGVSLLGGCCRTTPTTIRAIHKRL 327
>YM99_YEAST (Q04898) Hypothetical protein YMR321c| Length = 105 Score = 37.7 bits (86), Expect = 0.013 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = -3 Query: 443 EWCKDGAALIGGCCRTTPNTIRAISRSLNQY 351 ++ GA +IGGCCRT+P I+ IS ++ +Y Sbjct: 74 QYISSGARIIGGCCRTSPKDIQEISAAVKKY 104
>SAM4_YEAST (Q08985) Homocysteine S-methyltransferase 2 (EC 2.1.1.10)| (S-methylmethionine:homocysteine methyltransferase 2) (SMM:Hcy S-methyltransferase 2) (S-adenosylmethionine metabolism protein 4) Length = 325 Score = 37.7 bits (86), Expect = 0.013 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = -3 Query: 443 EWCKDGAALIGGCCRTTPNTIRAISRSLNQY 351 ++ GA +IGGCCRT+P I+ IS ++ +Y Sbjct: 294 QYISSGARIIGGCCRTSPKDIQEISAAVKKY 324
>MMUM_ECOLI (Q47690) Homocysteine S-methyltransferase (EC 2.1.1.10)| (S-methylmethionine:homocysteine methyltransferase) Length = 310 Score = 36.2 bits (82), Expect = 0.037 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 443 EWCKDGAALIGGCCRTTPNTIRAI 372 +W GA LIGGCCRTTP I A+ Sbjct: 283 QWQAAGARLIGGCCRTTPADIAAL 306
>MHT1_YEAST (Q12525) Homocysteine S-methyltransferase 1 (EC 2.1.1.10)| (S-methylmethionine:homocysteine methyltransferase 1) (SMM:Hcy S-methyltransferase 1) Length = 324 Score = 35.4 bits (80), Expect = 0.063 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = -3 Query: 431 DGAALIGGCCRTTPNTIRAISRSLNQY 351 +GA +IGGCCRT+P I I+ ++++Y Sbjct: 297 NGARIIGGCCRTSPKDIAEIASAVDKY 323
>METH_VIBCH (Q9KUW9) Methionine synthase (EC 2.1.1.13)| (5-methyltetrahydrofolate--homocysteine methyltransferase) (Methionine synthase, vitamin-B12 dependent isozyme) (MS) Length = 1226 Score = 34.3 bits (77), Expect = 0.14 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -3 Query: 443 EWCKDGAA-LIGGCCRTTPNTIRAISRSLNQYYPAA 339 EW + G L+GGCC TTP I AI++++ P A Sbjct: 298 EWAQAGFLNLVGGCCGTTPEHIAAIAKAVEGVKPRA 333
>METH_VIBPA (Q87L95) Methionine synthase (EC 2.1.1.13)| (5-methyltetrahydrofolate--homocysteine methyltransferase) (Methionine synthase, vitamin-B12 dependent isozyme) (MS) Length = 1226 Score = 33.9 bits (76), Expect = 0.18 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -3 Query: 443 EWCKDGAA-LIGGCCRTTPNTIRAISRSLNQYYPAA 339 EW G LIGGCC TTP IR +++++ P A Sbjct: 298 EWASSGFLNLIGGCCGTTPEHIRQMAQAVEGVTPRA 333
>METH_ECOLI (P13009) Methionine synthase (EC 2.1.1.13)| (5-methyltetrahydrofolate--homocysteine methyltransferase) (Methionine synthase, vitamin-B12-dependent isozyme) (MS) Length = 1226 Score = 33.5 bits (75), Expect = 0.24 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 443 EWCKDGAA-LIGGCCRTTPNTIRAISRSLNQYYP 345 EW + G ++GGCC TTP I A+SR++ P Sbjct: 296 EWAQAGFLNIVGGCCGTTPQHIAAMSRAVEGLAP 329
>METH_SALTY (P37586) Methionine synthase (EC 2.1.1.13)| (5-methyltetrahydrofolate--homocysteine methyltransferase) (Methionine synthase, vitamin-B12 dependent isozyme) (MS) Length = 1226 Score = 33.1 bits (74), Expect = 0.31 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 443 EWCKDGAA-LIGGCCRTTPNTIRAISRSLNQYYP 345 EW + G ++GGCC TTP I A+SR++ P Sbjct: 296 EWAEAGFLNIVGGCCGTTPEHIAAMSRAVAGLLP 329
>METH_PSEPU (O33465) Methionine synthase (EC 2.1.1.13)| (5-methyltetrahydrofolate--homocysteine methyltransferase) (Methionine synthase, vitamin-B12 dependent isozyme) (MS) (Fragment) Length = 607 Score = 32.3 bits (72), Expect = 0.53 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = -3 Query: 419 LIGGCCRTTPNTIRAISRSLNQYYPAA*VFAAQSCTL 309 +IGGC TTP I+AI+ ++ +Y P A++C L Sbjct: 309 IIGGCSGTTPGHIQAIAEAVAKYKPREIPEIAKACRL 345
>METH_VIBVU (Q8DCJ7) Methionine synthase (EC 2.1.1.13)| (5-methyltetrahydrofolate--homocysteine methyltransferase) (Methionine synthase, vitamin-B12 dependent isozyme) (MS) Length = 1226 Score = 32.0 bits (71), Expect = 0.70 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -3 Query: 443 EWCKDGAA-LIGGCCRTTPNTIRAISRSLNQYYP 345 EW + G LIGGCC TTP IR ++ ++ P Sbjct: 298 EWAQSGFLNLIGGCCGTTPEHIRHMAMAVEGVSP 331
>METH_VIBVY (Q7MHB1) Methionine synthase (EC 2.1.1.13)| (5-methyltetrahydrofolate--homocysteine methyltransferase) (Methionine synthase, vitamin-B12 dependent isozyme) (MS) Length = 1226 Score = 31.6 bits (70), Expect = 0.91 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -3 Query: 443 EWCKDGAA-LIGGCCRTTPNTIRAISRSLNQYYP 345 EW + G LIGGCC TTP IR ++ ++ P Sbjct: 298 EWAQSGFLNLIGGCCGTTPEHIRHMAMAVEGESP 331
>METH_MYCLE (Q49775) Methionine synthase (EC 2.1.1.13)| (5-methyltetrahydrofolate--homocysteine methyltransferase) (Methionine synthase, vitamin-B12 dependent isozyme) (MS) Length = 1206 Score = 31.6 bits (70), Expect = 0.91 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = -3 Query: 428 GAALIGGCCRTTPNTIRAISRSL 360 G +L+GGCC TTP+ IR ++ ++ Sbjct: 292 GLSLVGGCCGTTPDHIREVAAAV 314
>METH_CAEEL (Q09582) Probable methionine synthase (EC 2.1.1.13)| (5-methyltetrahydrofolate--homocysteine methyltransferase) (Methionine synthase, vitamin-B12 dependent) (MS) Length = 1249 Score = 31.6 bits (70), Expect = 0.91 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 443 EWCKDGAA-LIGGCCRTTPNTIRAISRSLNQYYP 345 E+ +DG +IGGCC TTP+ I A+ +++ P Sbjct: 299 EFARDGLVNIIGGCCGTTPDHINAMYKAVQGITP 332
>METH_VIBFI (Q9AJQ8) Methionine synthase (EC 2.1.1.13)| (5-methyltetrahydrofolate--homocysteine methyltransferase) (Methionine synthase, vitamin-B12 dependent isozyme) (MS) Length = 1226 Score = 30.8 bits (68), Expect = 1.6 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -3 Query: 443 EWCKDGAA-LIGGCCRTTPNTIRAIS 369 EW G LIGGCC TTP IR ++ Sbjct: 299 EWASSGFLNLIGGCCGTTPEHIRQMA 324
>METH_VIBF1 (Q5E814) Methionine synthase (EC 2.1.1.13)| (5-methyltetrahydrofolate--homocysteine methyltransferase) (Methionine synthase, vitamin-B12 dependent isozyme) (MS) Length = 1226 Score = 30.8 bits (68), Expect = 1.6 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -3 Query: 443 EWCKDGAA-LIGGCCRTTPNTIRAIS 369 EW G LIGGCC TTP IR ++ Sbjct: 299 EWASSGFLNLIGGCCGTTPEHIRQMA 324
>METH_MYCTU (O33259) Methionine synthase (EC 2.1.1.13)| (5-methyltetrahydrofolate--homocysteine methyltransferase) (Methionine synthase, vitamin-B12 dependent isozyme) (MS) Length = 1192 Score = 30.4 bits (67), Expect = 2.0 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -3 Query: 428 GAALIGGCCRTTPNTIRAISRSL 360 G +L+GGCC TTP IR ++ ++ Sbjct: 290 GLSLVGGCCGTTPAHIREVAAAV 312
>ARLY_PROMM (Q7TV86) Argininosuccinate lyase (EC 4.3.2.1) (Arginosuccinase)| (ASAL) Length = 470 Score = 29.3 bits (64), Expect = 4.5 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 192 RRFANVSAQLSHFAGERHAAITKSPGHVGNITPGVTSLKEGTTLC 326 RR ++ +L F +HA +T++ H + PG T L+ LC Sbjct: 131 RRLDDLDCELERF---QHALLTQAESHRQTLIPGYTHLQRAQPLC 172
>METH_HUMAN (Q99707) Methionine synthase (EC 2.1.1.13)| (5-methyltetrahydrofolate--homocysteine methyltransferase) (Methionine synthase, vitamin-B12 dependent) (MS) Length = 1265 Score = 29.3 bits (64), Expect = 4.5 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 443 EWCKDGAA-LIGGCCRTTPNTIRAISRSLNQYYP 345 ++ DG ++GGCC +TP+ IR I+ ++ P Sbjct: 310 DFAMDGLVNIVGGCCGSTPDHIREIAEAVKNCKP 343
>NUD10_ARATH (Q6NPD7) Nudix hydrolase 10 (EC 3.6.1.-) (AtNUDT10) (ADP-ribose| pyrophosphatase) (EC 3.6.1.13) (NADH pyrophosphatase) (EC 3.6.1.22) Length = 277 Score = 28.5 bits (62), Expect = 7.7 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 360 KRSTYCSDGVWSCPAAAPDKGSPIFA 437 K + C G+W P D+G IFA Sbjct: 127 KYGSLCGSGIWKIPTGVVDEGEEIFA 152 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,386,568 Number of Sequences: 219361 Number of extensions: 1127766 Number of successful extensions: 2696 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 2616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2695 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)