Clone Name | rbart55d11 |
---|---|
Clone Library Name | barley_pub |
>CHIT1_TULBA (Q9SLP4) Chitinase 1 precursor (EC 3.2.1.14) (Tulip bulb| chitinase-1) (TBC-1) Length = 314 Score = 62.8 bits (151), Expect = 4e-10 Identities = 34/87 (39%), Positives = 51/87 (58%), Gaps = 1/87 (1%) Frame = -3 Query: 472 TDVQTYVMFYDRQTGYYPGAKVLASLQTGKTTEELGLLSPDQGIAAAKELLR-QNKLPGF 296 T V+ ++ +++ Q+ Y G KVL S +T+ G L PD G A +L+ Q KL G Sbjct: 219 TSVEQFLKYFEEQSSNYHGGKVLVSF----STDSSGGLKPDNGFFRACSILKKQGKLHGI 274 Query: 295 FIWSADSSKQSDYKFTYETRAQEIVAN 215 F+WSAD S S+ F YE +AQ ++A+ Sbjct: 275 FVWSADDSLMSNNVFRYEMQAQSMLAS 301
>CHIT2_TULBA (Q7M443) Chitinase 2 (EC 3.2.1.14) (Tulip bulb chitinase-2) (TBC-2)| Length = 275 Score = 59.7 bits (143), Expect = 4e-09 Identities = 33/85 (38%), Positives = 49/85 (57%), Gaps = 1/85 (1%) Frame = -3 Query: 466 VQTYVMFYDRQTGYYPGAKVLASLQTGKTTEELGLLSPDQGIAAAKELLR-QNKLPGFFI 290 V+ ++ +++ Q YPG KVL S +T+ G L P G A +L+ Q KL G F+ Sbjct: 195 VEQFLKYFEMQRSNYPGGKVLVSF----STDNSGGLKPRNGFFDACSILKKQGKLHGIFV 250 Query: 289 WSADSSKQSDYKFTYETRAQEIVAN 215 WSAD S S+ F YE +AQ ++A+ Sbjct: 251 WSADDSLMSNDVFKYEMQAQSLLAS 275
>CARB_SYNY3 (Q55756) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1081 Score = 29.6 bits (65), Expect = 4.2 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = -3 Query: 454 VMFYDRQTGYYPGAKVLASLQTGKTTEELGLLSP--DQGIAAAKELLRQNKLPG 299 V + + TG P AK+ + + +GKT EELG+ Q +A + +L +K PG Sbjct: 858 VPYVSKATGR-PLAKIASLVMSGKTLEELGVTEEFIPQHVAVKEAVLPFSKFPG 910
>KPRS_BACSU (P14193) Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) (RPPK)| (Phosphoribosyl pyrophosphate synthetase) (P-Rib-PP synthetase) (PRPP synthetase) Length = 317 Score = 29.3 bits (64), Expect = 5.5 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -3 Query: 448 FYDRQTGYYPGAKVLASLQTGKTTEELGLLSPDQ-GIAAAKELLRQNKLP 302 F+D + G +L GK E++ ++SPD G+ A++L + K P Sbjct: 143 FFDIPIDHLMGVPILGEYFEGKNLEDIVIVSPDHGGVTRARKLADRLKAP 192
>CARB_ANASP (Q8YQL2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1104 Score = 28.5 bits (62), Expect = 9.4 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = -3 Query: 454 VMFYDRQTGYYPGAKVLASLQTGKTTEELGLLSP--DQGIAAAKELLRQNKLPG 299 V F + TG P AK+ + + +GKT EEL IA + +L NK PG Sbjct: 880 VPFVSKATGV-PLAKLASLIMSGKTLEELNFTQEVIPSHIAVKEAVLPFNKFPG 932
>AKIB1_MOUSE (Q6ZPS6) Ankyrin repeat and IBR domain-containing protein 1| (Fragment) Length = 1087 Score = 28.5 bits (62), Expect = 9.4 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 239 GLIGELVVALLGAVRRPDEEPRQLVLPQQLLGRGDALVR 355 G IG + + L +V R E PR + +LL GD+L+R Sbjct: 883 GAIGSSLPSRLDSVPRSTESPRAALSSSELLELGDSLMR 921 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,569,972 Number of Sequences: 219361 Number of extensions: 1041673 Number of successful extensions: 2859 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2858 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)