ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart55c12 |
|---|---|
| Clone Library Name | barley_pub |
>DCL_LYCES (Q42463) DCL protein, chloroplast precursor (Defective chloroplasts| and leaves protein) Length = 224 Score = 45.8 bits (107), Expect = 5e-05 Identities = 22/46 (47%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = -1 Query: 454 KKIGSGVDAFEIRNHPVWQ-SRCFFIRRVDGSADDFSFRKCVDNIL 320 KKIG GVD + HP ++ SRC FI R DG DFS+ KC+ ++ Sbjct: 156 KKIGPGVDYITVGYHPDFENSRCLFIVRKDGETVDFSYWKCIKGLI 201
>KRA48_HUMAN (Q9BYQ9) Keratin-associated protein 4-8 (Keratin-associated protein| 4.8) (Ultrahigh sulfur keratin-associated protein 4.8) (Fragment) Length = 114 Score = 33.1 bits (74), Expect = 0.35 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 253 PCSGHPSCHLNSCCQPSGPRGEEVCCPRTC 342 P HPSC ++SCC+PS CC +C Sbjct: 51 PTCCHPSCSISSCCRPS-------CCESSC 73 Score = 32.3 bits (72), Expect = 0.59 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 8/38 (21%) Frame = +1 Query: 253 PCSGHPSCHLNSCCQPS-------GPR-GEEVCCPRTC 342 P HPSC ++SCC+PS P+ + VCC TC Sbjct: 16 PTCCHPSCCISSCCRPSCCVSSCCKPQCCQSVCCQPTC 53
>KR414_HUMAN (Q9BYQ6) Keratin-associated protein 4-14 (Keratin-associated| protein 4.14) (Ultrahigh sulfur keratin-associated protein 4.14) Length = 195 Score = 33.1 bits (74), Expect = 0.35 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 253 PCSGHPSCHLNSCCQPSGPRGEEVCCPRTC 342 P HPSC ++SCC+PS CC +C Sbjct: 132 PTCCHPSCSISSCCRPS-------CCESSC 154 Score = 29.6 bits (65), Expect = 3.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRGEEVCCPRTC 342 PSC ++SCC+P + VCC TC Sbjct: 42 PSCCVSSCCRPQ--CCQSVCCQPTC 64 Score = 28.5 bits (62), Expect = 8.6 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRGEEVCCPRTC 342 PSC ++SCC+P + +CC TC Sbjct: 77 PSCCVSSCCKPQ--CCQSMCCQPTC 99
>KRA44_HUMAN (Q9BYR3) Keratin-associated protein 4-4 (Keratin-associated protein| 4.4) (Ultrahigh sulfur keratin-associated protein 4.4) Length = 166 Score = 32.7 bits (73), Expect = 0.45 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 265 HPSCHLNSCCQPSGPRGEEVCCPRTC 342 HPSC ++SCC+P + VCC TC Sbjct: 62 HPSCCVSSCCRPQ--CCQSVCCQPTC 85
>KRA47_HUMAN (Q9BYR0) Keratin-associated protein 4-7 (Keratin-associated protein| 4.7) (Ultrahigh sulfur keratin-associated protein 4.7) Length = 210 Score = 32.3 bits (72), Expect = 0.59 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 8/38 (21%) Frame = +1 Query: 253 PCSGHPSCHLNSCCQPS-------GPR-GEEVCCPRTC 342 P HPSC ++SCC+PS P+ + VCC TC Sbjct: 107 PTCCHPSCCISSCCRPSCCVSRCCRPQCCQSVCCQPTC 144 Score = 30.0 bits (66), Expect = 2.9 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 8/34 (23%) Frame = +1 Query: 265 HPSCHLNSCCQPSGPRG--------EEVCCPRTC 342 HP C ++SCC+PS + VCC TC Sbjct: 76 HPRCCISSCCRPSCCMSSCCKPQCCQSVCCQPTC 109 Score = 29.6 bits (65), Expect = 3.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRGEEVCCPRTC 342 PSC ++SCC+P + VCC TC Sbjct: 42 PSCCVSSCCRPQ--CCQSVCCQPTC 64 Score = 29.3 bits (64), Expect = 5.0 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 253 PCSGHPSCHLNSCCQPSGPRGEEVCCPRTC 342 P PSC ++SCC+PS CC +C Sbjct: 142 PTCCRPSCCISSCCRPS-------CCESSC 164
>KR410_HUMAN (Q9BYQ7) Keratin-associated protein 4-10 (Keratin-associated| protein 4.10) (Ultrahigh sulfur keratin-associated protein 4.10) Length = 127 Score = 30.8 bits (68), Expect = 1.7 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRGEEVCCPRTC 342 PSC ++SCC+PS + CC TC Sbjct: 37 PSCVVSSCCRPS--CSQTTCCQTTC 59 Score = 28.9 bits (63), Expect = 6.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRGEEVCCPRTC 342 PSC ++SCC+P +CC TC Sbjct: 95 PSCGVSSCCRP-------LCCQTTC 112 Score = 28.9 bits (63), Expect = 6.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRGEEVCCPRTC 342 PSC ++SCC+P +CC TC Sbjct: 76 PSCGVSSCCRP-------LCCQTTC 93
>KRA98_HUMAN (Q9BYQ0) Keratin-associated protein 9-8 (Keratin-associated protein| 9.8) (Ultrahigh sulfur keratin-associated protein 9.8) Length = 159 Score = 30.8 bits (68), Expect = 1.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 253 PCSGHPSCHLNSCCQPSGPRGEEVCCPRTC 342 PC PSC ++SCCQP CC TC Sbjct: 31 PCC-QPSCCVSSCCQPC---CRPTCCQNTC 56 Score = 28.5 bits (62), Expect = 8.6 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 13/45 (28%) Frame = +1 Query: 253 PCSGHPSCHLNSCCQP------------SGPRGEEVCCPRT-CGS 348 PC P+C N+CCQP S P + CC +T CGS Sbjct: 45 PCC-RPTCCQNTCCQPICVTSCCQPSCCSTPCCQPTCCGQTSCGS 88
>KRA93_HUMAN (Q9BYQ3) Keratin-associated protein 9-3 (Keratin-associated protein| 9.3) (Ultrahigh sulfur keratin-associated protein 9.3) Length = 159 Score = 30.8 bits (68), Expect = 1.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 253 PCSGHPSCHLNSCCQPSGPRGEEVCCPRTC 342 PC PSC ++SCCQP CC TC Sbjct: 31 PCC-QPSCCVSSCCQPC---CHPTCCQNTC 56
>KRA99_HUMAN (Q9BYP9) Keratin-associated protein 9-9 (Keratin-associated protein| 9.9) (Ultrahigh sulfur keratin-associated protein 9.9) Length = 154 Score = 30.8 bits (68), Expect = 1.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 253 PCSGHPSCHLNSCCQPSGPRGEEVCCPRTC 342 PC PSC ++SCCQP CC TC Sbjct: 36 PCC-QPSCCVSSCCQPC---CRPACCQNTC 61
>KRA94_HUMAN (Q9BYQ2) Keratin-associated protein 9-4 (Keratin-associated protein| 9.4) (Ultrahigh sulfur keratin-associated protein 9.4) Length = 154 Score = 30.8 bits (68), Expect = 1.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 253 PCSGHPSCHLNSCCQPSGPRGEEVCCPRTC 342 PC PSC ++SCCQP CC TC Sbjct: 36 PCC-QPSCCVSSCCQPC---CRPTCCQNTC 61
>KRA45_HUMAN (Q9BYR2) Keratin-associated protein 4-5 (Keratin-associated protein| 4.5) (Ultrahigh sulfur keratin-associated protein 4.5) Length = 186 Score = 30.4 bits (67), Expect = 2.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 253 PCSGHPSCHLNSCCQPSGPRGEEVCCPRTC 342 P HPSC ++SCC+P CC +C Sbjct: 53 PTCCHPSCCISSCCRP-------YCCESSC 75 Score = 29.6 bits (65), Expect = 3.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRGEEVCCPRTC 342 PSC ++SCC+P + VCC TC Sbjct: 103 PSCCVSSCCRPQ--CCQSVCCQPTC 125 Score = 29.3 bits (64), Expect = 5.0 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 253 PCSGHPSCHLNSCCQPSGPRGEEVCCPRTCGS 348 PC PSC +CC+ + R CCP C S Sbjct: 78 PCCCRPSCCQTTCCRTTCCR-TTCCCPSCCVS 108
>KR415_HUMAN (Q9BYQ5) Keratin-associated protein 4-15 (Keratin-associated| protein 4.15) (Ultrahigh sulfur keratin-associated protein 4.15) (Fragment) Length = 193 Score = 30.4 bits (67), Expect = 2.3 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 8/38 (21%) Frame = +1 Query: 253 PCSGHPSCHLNSCCQPS--------GPRGEEVCCPRTC 342 P PSC ++SCC+PS + VCC TC Sbjct: 90 PTCCRPSCSISSCCRPSCCVSRCCRSQCCQSVCCQPTC 127 Score = 29.6 bits (65), Expect = 3.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRGEEVCCPRTC 342 PSC ++SCC+P + VCC TC Sbjct: 70 PSCCVSSCCRPQ--CCQSVCCQPTC 92 Score = 29.6 bits (65), Expect = 3.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRGEEVCCPRTC 342 PSC ++SCC+P + VCC TC Sbjct: 26 PSCCVSSCCRPQ--CCQSVCCQPTC 48 Score = 29.3 bits (64), Expect = 5.0 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 253 PCSGHPSCHLNSCCQPSGPRGEEVCCPRTC 342 P PSC ++SCC+PS CC +C Sbjct: 125 PTCCRPSCCISSCCRPS-------CCESSC 147
>KRA42_HUMAN (Q9BYR5) Keratin-associated protein 4-2 (Keratin-associated protein| 4.2) (Ultrahigh sulfur keratin-associated protein 4.2) Length = 136 Score = 30.0 bits (66), Expect = 2.9 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRGEEVCCPRTCGS 348 PSC ++SCC+P + VCC TC S Sbjct: 38 PSCCVSSCCRPQ--CCQSVCCQPTCCS 62 Score = 28.5 bits (62), Expect = 8.6 Identities = 12/28 (42%), Positives = 15/28 (53%), Gaps = 3/28 (10%) Frame = +1 Query: 268 PSCHLNSCCQPSGPR---GEEVCCPRTC 342 P C + CCQP+ R G+ CC TC Sbjct: 88 PQCCQSVCCQPTCCRPSCGQTTCCRTTC 115
>KRA43_HUMAN (Q9BYR4) Keratin-associated protein 4-3 (Keratin-associated protein| 4.3) (Ultrahigh sulfur keratin-associated protein 4.3) (Fragment) Length = 98 Score = 30.0 bits (66), Expect = 2.9 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRGEEVCCPRTC 342 PSC ++SCC+PS CC TC Sbjct: 15 PSCCISSCCKPS-------CCQTTC 32
>KR412_HUMAN (Q9BQ66) Keratin-associated protein 4-12 (Keratin-associated| protein 4.12) (Ultrahigh sulfur keratin-associated protein 4.12) Length = 201 Score = 29.6 bits (65), Expect = 3.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRGEEVCCPRTC 342 PSC ++SCC+P + VCC TC Sbjct: 118 PSCCVSSCCRPQ--CCQSVCCQPTC 140 Score = 29.6 bits (65), Expect = 3.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRGEEVCCPRTC 342 PSC ++SCC+P + VCC TC Sbjct: 78 PSCCVSSCCRPQ--CCQSVCCQPTC 100 Score = 29.6 bits (65), Expect = 3.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRGEEVCCPRTC 342 PSC ++SCC+P + VCC TC Sbjct: 38 PSCCVSSCCRPQ--CCQSVCCQPTC 60
>KRA49_HUMAN (Q9BYQ8) Keratin-associated protein 4-9 (Keratin-associated protein| 4.9) (Ultrahigh sulfur keratin-associated protein 4.9) (Fragment) Length = 191 Score = 29.6 bits (65), Expect = 3.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRGEEVCCPRTC 342 PSC ++SCC+P + VCC TC Sbjct: 23 PSCCVSSCCRPQ--CCQSVCCQPTC 45 Score = 29.3 bits (64), Expect = 5.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRGEEVCCPRTC 342 PSC ++SCC+PS CC +C Sbjct: 133 PSCSISSCCRPS-------CCESSC 150 Score = 29.3 bits (64), Expect = 5.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 265 HPSCHLNSCCQPSGPRGEEVCCPRTC 342 HP C ++SCC+PS CC +C Sbjct: 97 HPRCCISSCCRPS-------CCVSSC 115 Score = 29.3 bits (64), Expect = 5.0 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRGEEVCCPRTC 342 PSC ++SCC+P + VCC TC Sbjct: 63 PSCCVSSCCRPQ--CCQPVCCQPTC 85
>EP300_HUMAN (Q09472) E1A-associated protein p300 (EC 2.3.1.48)| Length = 2414 Score = 29.3 bits (64), Expect = 5.0 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +1 Query: 271 SCHLNSCCQPSGPRGEEVCCPRTCGS*NHQQNHRPCG*RN-IGSATPGGCGSQRHP 435 SC +NS P G +G + CP+ HQ + P R TP G+Q+ P Sbjct: 800 SCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPP 855
>KR10B_HUMAN (P60412) Keratin-associated protein 10-11 (Keratin-associated| protein 10.11) (High sulfur keratin-associated protein 10.11) (Keratin-associated protein 18-11) (Keratin-associated protein 18.11) Length = 298 Score = 29.3 bits (64), Expect = 5.0 Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 6/34 (17%) Frame = +1 Query: 265 HPSCH------LNSCCQPSGPRGEEVCCPRTCGS 348 HP C ++SCC P+ CCP +C S Sbjct: 242 HPVCRSTCCVPVSSCCAPTSSCQSSCCCPASCVS 275
>TENA_CHICK (P10039) Tenascin precursor (TN) (Hexabrachion) (Cytotactin)| (Neuronectin) (GMEM) (JI) (Miotendinous antigen) (Glioma-associated-extracellular matrix antigen) (GP 150-225) Length = 1808 Score = 28.9 bits (63), Expect = 6.6 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 5/34 (14%) Frame = +1 Query: 256 CSGHPSCHLNSC---CQPS--GPRGEEVCCPRTC 342 CSGH + C C+P GP E CPR C Sbjct: 163 CSGHGNYSTEICGCVCEPGWKGPNCSEPACPRNC 196
>TENR_CHICK (Q00546) Tenascin-R precursor (TN-R) (Restrictin)| Length = 1353 Score = 28.9 bits (63), Expect = 6.6 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Frame = +1 Query: 253 PCSGHPSCHLNSC---CQP--SGPRGEEVCCPRTCGS 348 PCSGH + L SC C +G E CPR C S Sbjct: 173 PCSGHGNFSLESCRCICSEGWAGSNCSEPRCPRGCSS 209
>KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-associated protein| 5.3) (Ultrahigh sulfur keratin-associated protein 5.3) (Keratin-associated protein 5-9) (Keratin-associated protein 5.9) (UHS KerB-like) Length = 238 Score = 28.5 bits (62), Expect = 8.6 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = +1 Query: 268 PSCHLNSCCQPSGPRG---EEVCCPRTCGS 348 PSC +SCC+P + + CC CGS Sbjct: 153 PSCSQSSCCKPCCSQSSCCKPCCCSSGCGS 182
>ITB4_RAT (Q64632) Integrin beta-4 precursor (GP150) (CD104 antigen)| Length = 1807 Score = 28.5 bits (62), Expect = 8.6 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 7/38 (18%) Frame = +1 Query: 253 PCSGHPSCHLNSC-CQPSGPRGEEVC------CPRTCG 345 PCSGH C C C G C CPRT G Sbjct: 512 PCSGHGECQCGRCVCYGEGRYEGHFCEYDNFQCPRTSG 549 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,615,254 Number of Sequences: 219361 Number of extensions: 1044142 Number of successful extensions: 3174 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 2961 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3145 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
