ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart55b05 |
|---|---|
| Clone Library Name | barley_pub |
>CS1B_MOUSE (Q8CFG8) Complement C1s-B subcomponent precursor (EC 3.4.21.42) (C1| esterase) [Contains: Complement C1s-B subcomponent heavy chain; Complement C1s-B subcomponent light chain] Length = 688 Score = 29.3 bits (64), Expect = 2.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -3 Query: 276 EMACAVTGRDGDDRVGFAIPACVCVC 199 E CA GR +D++G +P C+ VC Sbjct: 400 EYRCAANGRWVNDQLGIELPRCIPVC 425
>RBGPR_HUMAN (Q9H2M9) Rab3 GTPase-activating protein non-catalytic subunit (Rab3| GTPase-activating protein 150 kDa subunit) (Rab3-GAP p150) (Rab3-GAP regulatory subunit) (RAB3-GAP150) (RGAP-iso) Length = 1393 Score = 29.3 bits (64), Expect = 2.7 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 173 GEKQAHCLLHTQTHAGMAKPTRSSPS 250 G++ AH LLHTQT GM R P+ Sbjct: 1309 GQRLAHALLHTQTKEGMELLARLPPT 1334
>HAND1_CHICK (Q90691) Heart- and neural crest derivatives-expressed protein 1| (Extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1) (eHAND) Length = 202 Score = 29.3 bits (64), Expect = 2.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 219 GWRNRHDHHHHGRLPRKPFL 278 G+++ H HHHH + +PFL Sbjct: 6 GYQHHHHHHHHHHMLHEPFL 25
>DLGP2_MOUSE (Q8BJ42) Disks large-associated protein 2 (DAP-2)| (SAP90/PSD-95-associated protein 2) (SAPAP2) (PSD-95/SAP90-binding protein 2) Length = 1059 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Frame = +3 Query: 234 HDHHHHGRLPRKPFLSS--ESC 293 HDH HHG R+P+L S ESC Sbjct: 110 HDHMHHGSDVRQPYLLSPAESC 131
>RCNA_ECOL6 (Q8FFX9) Nickel/cobalt efflux system rcnA| Length = 274 Score = 28.5 bits (62), Expect = 4.6 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = +3 Query: 123 FWFFISTRTTKN*TKKGERNKRTAYYTHKHTLGWRNRHDHHHHG 254 FW F T +GERN + H H + DHH HG Sbjct: 103 FWMFWRTW-------RGERNWLENMHEHDHEHHHHDHEDHHDHG 139
>CAC1H_HUMAN (O95180) Voltage-dependent T-type calcium channel alpha-1H subunit| (Voltage-gated calcium channel alpha subunit Cav3.2) (Low-voltage-activated calcium channel alpha1 3.2 subunit) Length = 2353 Score = 28.5 bits (62), Expect = 4.6 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 5/46 (10%) Frame = +3 Query: 171 GERNKRTAYYTHK-HTLGWRNRHDHHHHGRL----PRKPFLSSESC 293 G R +R +T H L + + H HHHH PR+P +C Sbjct: 501 GHRQRRAGRHTASVHHLVYHHHHHHHHHYHFSHGSPRRPGPEPGAC 546
>Y200_ANASP (Q8Z098) UPF0272 protein All0200| Length = 426 Score = 28.1 bits (61), Expect = 6.0 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +3 Query: 165 KKGERNKRTAYYTHKHTLGWRNR-HDHHHHGR 257 +K +RN + A H L + H+HHHHGR Sbjct: 50 EKVQRNGQEATKVHVDLLDHHHHDHEHHHHGR 81
>NKTR_HUMAN (P30414) NK-tumor recognition protein (Natural-killer cells| cyclophilin-related protein) (NK-TR protein) Length = 1462 Score = 27.7 bits (60), Expect = 7.8 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 152 KELNKKRGEKQAHCLLHTQT 211 K +KK+G+KQ HC H QT Sbjct: 435 KVKHKKKGKKQKHCRRHKQT 454
>CS1A_MOUSE (Q8CG14) Complement C1s-A subcomponent precursor (EC 3.4.21.42) (C1| esterase) [Contains: Complement C1s-A subcomponent heavy chain; Complement C1s-A subcomponent light chain] Length = 688 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 276 EMACAVTGRDGDDRVGFAIPACVCVC 199 E CA GR +D++G +P C+ C Sbjct: 400 EYRCAANGRWVNDQLGIELPRCIPAC 425
>RBGPR_MOUSE (Q8BMG7) Rab3 GTPase-activating protein non-catalytic subunit (Rab3| GTPase-activating protein 150 kDa subunit) (Rab3-GAP p150) (Rab3-GAP regulatory subunit) (RAB3-GAP150) Length = 1366 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 173 GEKQAHCLLHTQTHAGMAKPTRSSPS 250 G++ AH L HTQT GM R P+ Sbjct: 1284 GQRLAHALFHTQTKEGMELLARLPPT 1309
>MES1_SCHPO (P41005) Protein mes1| Length = 101 Score = 27.7 bits (60), Expect = 7.8 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = -1 Query: 293 AALRTQKWLAR*PAVMVMIVSVSPSQRVFVCVVSSALVSLPFFCLILCSSGRNEKP 126 A R Q+ L R P + I V PSQ + V + S +F + +SG+N P Sbjct: 24 ALYRVQRPLQRRPLQELSIELVKPSQTITVKKSKKSTNSSSYFAQLHAASGQNPPP 79
>RBGPR_RAT (Q5U1Z0) Rab3 GTPase-activating protein non-catalytic subunit (Rab3| GTPase-activating protein 150 kDa subunit) (Rab3-GAP p150) (Rab3-GAP regulatory subunit) (RAB3-GAP150) Length = 1386 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 173 GEKQAHCLLHTQTHAGMAKPTRSSPS 250 G++ AH L HTQT GM R P+ Sbjct: 1304 GQRLAHALFHTQTKEGMELLARLPPT 1329
>NR4A3_HUMAN (Q92570) Orphan nuclear receptor NR4A3 (Nuclear hormone receptor| NOR-1) (Neuron-derived orphan receptor 1) (Mitogen-induced nuclear orphan receptor) Length = 626 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +3 Query: 168 KGERNKRTAYYTHKHTLGWRNRHDHHHHGRLPRKPFLSSES 290 K E + +Y+ H H + H HHHH + ++P + S Sbjct: 85 KVEEGRAPSYHHHHH----HHHHHHHHHQQQHQQPSIPPAS 121 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,921,316 Number of Sequences: 219361 Number of extensions: 695166 Number of successful extensions: 2656 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2207 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2536 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
