| Clone Name | rbart55a03 |
|---|---|
| Clone Library Name | barley_pub |
>DCNL4_BRARE (Q5RHX6) DCN1-like protein 4 (Defective in cullin neddylation| protein 1-like protein 4) (DCUN1 domain-containing protein 4) Length = 280 Score = 51.6 bits (122), Expect = 1e-06 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -3 Query: 498 NMDQWMGFLRFCNEINFPSLDNYDADQAWPLILDNFVEWLRANE 367 N DQW L F IN L NYD D AWP++LD FVEW + E Sbjct: 236 NKDQWCNVLEFSRTINL-DLSNYDEDGAWPVLLDEFVEWYKDRE 278
>DCNL4_HUMAN (Q92564) DCN1-like protein 4 (Defective in cullin neddylation| protein 1-like protein 4) (DCUN1 domain-containing protein 4) Length = 292 Score = 50.4 bits (119), Expect = 3e-06 Identities = 22/41 (53%), Positives = 25/41 (60%) Frame = -3 Query: 498 NMDQWMGFLRFCNEINFPSLDNYDADQAWPLILDNFVEWLR 376 N DQW L F IN L NYD D AWP++LD FVEW + Sbjct: 248 NKDQWCNVLEFSRTINL-DLSNYDEDGAWPVLLDEFVEWYK 287
>DCNL4_MOUSE (Q8CCA0) DCN1-like protein 4 (Defective in cullin neddylation| protein 1-like protein 4) (DCUN1 domain-containing protein 4) Length = 292 Score = 48.5 bits (114), Expect = 1e-05 Identities = 21/41 (51%), Positives = 25/41 (60%) Frame = -3 Query: 498 NMDQWMGFLRFCNEINFPSLDNYDADQAWPLILDNFVEWLR 376 N DQW L F I+ L NYD D AWP++LD FVEW + Sbjct: 248 NKDQWCNVLEFSRTISL-DLSNYDEDGAWPVLLDEFVEWYK 287
>DCN1_USTMA (Q4PF67) Defective in cullin neddylation protein 1| Length = 319 Score = 47.8 bits (112), Expect = 2e-05 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = -3 Query: 492 DQWMGFLRFCNEINFPSLDNYDADQAWPLILDNFVEWLRAN 370 D WM FL F EIN N+D D AWP I+D+FV W+R N Sbjct: 270 DTWMQFLDFTKEIN-SDFSNHDFDAAWPSIIDDFVLWVRDN 309
>DCN1L_DROME (Q9VUQ8) DCN1-like protein (Defective in cullin neddylation protein| 1-like protein) Length = 288 Score = 42.7 bits (99), Expect = 5e-04 Identities = 17/43 (39%), Positives = 28/43 (65%) Frame = -3 Query: 492 DQWMGFLRFCNEINFPSLDNYDADQAWPLILDNFVEWLRANEN 364 D W L F I+ + NYD++ AWP+++D+FVEW + N++ Sbjct: 207 DTWNLLLDFATNID-DRMSNYDSEGAWPVLIDDFVEWCQENDH 248
>DCN1_CAEEL (Q9U3C8) Defective in cullin neddylation protein 1| Length = 295 Score = 38.1 bits (87), Expect = 0.013 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = -3 Query: 492 DQWMGFLRFCNEINFPSLDNYDADQAWPLILDNFVEWLRANEN*P 358 D W F F ++ P L +YD + AWP+++D FV++ R N N P Sbjct: 235 DTWNLFWDFIL-LSKPDLSDYDDEGAWPVLIDQFVDYCRENLNYP 278
>DCNL2_MOUSE (Q8BZJ7) DCN1-like protein 2 (Defective in cullin neddylation| protein 2-like protein 2) (DCUN1 domain-containing protein 2) Length = 258 Score = 37.4 bits (85), Expect = 0.023 Identities = 18/39 (46%), Positives = 24/39 (61%) Frame = -3 Query: 492 DQWMGFLRFCNEINFPSLDNYDADQAWPLILDNFVEWLR 376 D W L F N I L NYD + AWP+++D+FVE+ R Sbjct: 210 DTWNLLLDFGNMIA-DDLSNYDEEGAWPVLIDDFVEYAR 247
>DCN1_YARLI (Q6C0B6) Defective in cullin neddylation protein 1| Length = 240 Score = 37.0 bits (84), Expect = 0.030 Identities = 13/24 (54%), Positives = 20/24 (83%) Frame = -3 Query: 447 PSLDNYDADQAWPLILDNFVEWLR 376 PSL++YD D AWP ++D +VE+L+ Sbjct: 216 PSLESYDEDGAWPSVIDEYVEFLK 239
>DCNL2_HUMAN (Q6PH85) DCN1-like protein 2 (Defective in cullin neddylation| protein 2-like protein 2) (DCUN1 domain-containing protein 2) Length = 259 Score = 36.6 bits (83), Expect = 0.039 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = -3 Query: 492 DQWMGFLRFCNEINFPSLDNYDADQAWPLILDNFVEWLR 376 D W L F N I + NYD + AWP+++D+FVE+ R Sbjct: 211 DTWNLLLDFGNMIA-DDMSNYDEEGAWPVLIDDFVEYAR 248
>DCNL1_MOUSE (Q9QZ73) DCN1-like protein 1 (Defective in cullin neddylation| protein 1-like protein 1) (DCUN1 domain-containing protein 1) (Testis-specific protein 3) Length = 259 Score = 35.0 bits (79), Expect = 0.11 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = -3 Query: 492 DQWMGFLRFCNEINFPSLDNYDADQAWPLILDNFVEWLR 376 D W L F + I + NYD + AWP+++D+FVE+ R Sbjct: 211 DTWNLLLDFSSMIA-DDMSNYDEEGAWPVLIDDFVEFAR 248
>DCNL1_HUMAN (Q96GG9) DCN1-like protein 1 (Defective in cullin neddylation| protein 1-like protein 1) (DCUN1 domain-containing protein 1) (Squamous cell carcinoma-related oncogene) Length = 259 Score = 34.7 bits (78), Expect = 0.15 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = -3 Query: 492 DQWMGFLRFCNEINFPSLDNYDADQAWPLILDNFVEWLR 376 D W L F I + NYD + AWP+++D+FVE+ R Sbjct: 211 DTWNLLLDFSTMIA-DDMSNYDEEGAWPVLIDDFVEFAR 248
>DCNL1_CHICK (Q5ZKU1) DCN1-like protein 1 (Defective in cullin neddylation| protein 1-like protein 1) (DCUN1 domain-containing protein 1) Length = 259 Score = 34.7 bits (78), Expect = 0.15 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = -3 Query: 492 DQWMGFLRFCNEINFPSLDNYDADQAWPLILDNFVEWLR 376 D W L F I + NYD + AWP+++D+FVE+ R Sbjct: 211 DTWNLLLDFSTMIA-DDMSNYDEEGAWPVLIDDFVEFAR 248
>DCN1_CAEBR (Q60YT5) Defective in cullin neddylation protein 1| Length = 292 Score = 34.3 bits (77), Expect = 0.19 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = -3 Query: 492 DQWMGFLRFCNEINFPSLDNYDADQAWPLILDNFVEWLRANEN*PSCTR 346 D W F F + L +YD + AWP+++D FV+ R N N P R Sbjct: 233 DTWNLFWDFI-VLGKEDLSDYDEEGAWPVLIDQFVDHCRENLNYPKPLR 280
>DCN1_CRYNE (Q5KHV1) Defective in cullin neddylation protein 1| Length = 279 Score = 33.1 bits (74), Expect = 0.43 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -3 Query: 492 DQWMGFLRFCNEINFPSLDNYDADQAWPLILDNFVEWLR 376 D W + F I+ YD D AWP ++D+FVE++R Sbjct: 236 DTWALLVDFARGID-KDFKEYDEDGAWPSMIDDFVEYVR 273
>DCN1_ASHGO (Q750Y3) Defective in cullin neddylation protein 1| Length = 256 Score = 32.7 bits (73), Expect = 0.56 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 4/43 (9%) Frame = -3 Query: 492 DQWMGFLRFCNEINFPS----LDNYDADQAWPLILDNFVEWLR 376 D W F RF FP L++Y+ +WPL++D + EW++ Sbjct: 211 DTWDMFPRFAQR--FPDDTELLEHYNELASWPLVIDEYYEWVK 251
>DCN1_SCHPO (Q8WZK4) Defective in cullin neddylation protein 1| Length = 251 Score = 32.0 bits (71), Expect = 0.95 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 447 PSLDNYDADQAWPLILDNFVEWLR 376 P+ NYD + AWP ++D FV + R Sbjct: 219 PNCSNYDFEGAWPTLIDEFVSYYR 242
>DCN1_MAGGR (Q52DM9) Defective in cullin neddylation protein 1| Length = 281 Score = 30.8 bits (68), Expect = 2.1 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -3 Query: 492 DQWMGFLRFCNEINFPS-LDNYDADQAWPLILDNFVEWLR 376 D W L F + S L + + +WP ++D FVEWLR Sbjct: 228 DMWNQTLDFAVKSTADSTLSFWTPEGSWPSVIDGFVEWLR 267
>DCN1_CANGA (Q6FJR2) Defective in cullin neddylation protein 1| Length = 273 Score = 30.8 bits (68), Expect = 2.1 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = -3 Query: 492 DQWMGFLRFCNEINFPSLD----NYDADQAWPLILDNFVEWL 379 D W L F + FPSLD Y+ AWP +D F E+L Sbjct: 228 DTWQMLLLFFKK--FPSLDAIKTEYNEADAWPYTIDEFYEYL 267
>TAXB1_RAT (Q66HA4) Tax1-binding protein 1 homolog (Liver regeneration-related| protein LRRG004) Length = 813 Score = 30.4 bits (67), Expect = 2.8 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +2 Query: 74 FKTSRKLHALETTHLQSH*KYKYRECRHKILDDDPAKCFKY 196 F S K H E T + KY +C+ ++L D+ AKC KY Sbjct: 517 FDMSAKDHVCEVTKEMAEKVEKYNKCK-QLLQDEKAKCNKY 556
>HANG_DROME (Q9VXG1) Zinc finger protein hangover| Length = 1959 Score = 30.0 bits (66), Expect = 3.6 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +2 Query: 50 EQHMPTCSFK--TSRKLHALETTHLQSH*KYKYRECRHKILDDD 175 + H PTC+ K TS H + L SH K RHK DDD Sbjct: 1230 DNHTPTCNRKPITSTGAHQQQDGQLHSHHTAKRTIFRHKTGDDD 1273
>DCN1_CANAL (Q5ADL9) Defective in cullin neddylation protein 1| Length = 304 Score = 29.6 bits (65), Expect = 4.7 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -3 Query: 492 DQWMGFLRFCNEINFPS---LDNYDADQAWPLILDNFVEWL 379 D W F F EI +YD AWP ++D F+E+L Sbjct: 258 DSWSMFYLFFKEIVLIDPIKFKDYDEMAAWPSVVDEFLEYL 298
>CHD3_HUMAN (Q12873) Chromodomain helicase-DNA-binding protein 3 (EC 3.6.1.-)| (ATP-dependent helicase CHD3) (CHD-3) (Mi-2 autoantigen 240 kDa protein) (Mi2-alpha) (Zinc-finger helicase) (hZFH) Length = 2000 Score = 29.6 bits (65), Expect = 4.7 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +2 Query: 131 KYKYRECRHKILDDDPAKCFKY*KVKSKLQGD 226 K Y R I+ +DPA+ KY K K +LQGD Sbjct: 677 KQSYWRHRELIMGEDPAQPRKYKKKKKELQGD 708
>CD180_HUMAN (Q99467) CD180 antigen precursor (Lymphocyte antigen 64)| (Radioprotective 105 kDa protein) Length = 661 Score = 29.3 bits (64), Expect = 6.2 Identities = 29/124 (23%), Positives = 52/124 (41%), Gaps = 3/124 (2%) Frame = +3 Query: 48 KNNICQHV---HLRLPENCMLLKLHTYKAIENTNIENVDIKF*MMTLLSVSSIKK*KANY 218 K N+ Q V + + +C LL + + +VD+ +T S+ S+ K Y Sbjct: 488 KTNLLQTVGSLEVLILSSCGLLSIDQQAFHSLGKMSHVDLSHNSLTCDSIDSLSHLKGIY 547 Query: 219 KAIDNF*NQTLNTAVTNELDLHPPKFSKVISEYCI*IASSPPLEYKRANFHLLLTIQQNC 398 LN A N +++ P+ ++S+ S PL+ +N H L ++N Sbjct: 548 ----------LNLAA-NSINIISPRLLPILSQQSTINLSHNPLDCTCSNIHFLTWYKENL 596 Query: 399 LKLK 410 KL+ Sbjct: 597 HKLE 600
>CBBYP_RALEU (Q04541) Protein cbbY, plasmid| Length = 254 Score = 29.3 bits (64), Expect = 6.2 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 329 NLNAILRNHLGEFWRMQIKLVCD 261 NL+A+L+ HLG WR + +CD Sbjct: 125 NLDALLQAHLGADWRGRFAAICD 147
>YNN1_CAEEL (Q03605) Hypothetical RING finger protein T02C1.1 in chromosome III| Length = 160 Score = 28.9 bits (63), Expect = 8.1 Identities = 14/56 (25%), Positives = 26/56 (46%) Frame = +3 Query: 60 CQHVHLRLPENCMLLKLHTYKAIENTNIENVDIKF*MMTLLSVSSIKK*KANYKAI 227 C HL + E C L + HT I N +E++ + + +S ++ K+ K + Sbjct: 31 CIESHLNINEKCPLCRAHTGNPIRNRQLESLTMSYVSSRNISTEYYERMKSYQKKL 86 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,595,802 Number of Sequences: 219361 Number of extensions: 1356265 Number of successful extensions: 2814 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 2764 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2813 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)