Clone Name | rbart55a02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CPRF1_PETCR (Q99089) Common plant regulatory factor CPRF-1 | 29 | 3.8 | 2 | DCR1_DROME (Q9VCU9) Endoribonuclease Dcr-1 (EC 3.1.26.-) (Protei... | 28 | 5.0 | 3 | IF1A_YEAST (P38912) Eukaryotic translation initiation factor 1A ... | 28 | 8.5 | 4 | GLYA_ANASP (Q8YMW8) Serine hydroxymethyltransferase (EC 2.1.2.1)... | 28 | 8.5 |
---|
>CPRF1_PETCR (Q99089) Common plant regulatory factor CPRF-1| Length = 411 Score = 28.9 bits (63), Expect = 3.8 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 22 LYNQNGAVIHVQYRAEAEHALNQPLPADHQKKNGTGRTTNASSYIKN 162 L N N ++ V A+AE A + L +++KK T T N S + N Sbjct: 325 LTNDNSRLLEVMKNAQAERAADVGLGNNNEKKASTLSTANLLSRVDN 371
>DCR1_DROME (Q9VCU9) Endoribonuclease Dcr-1 (EC 3.1.26.-) (Protein dicer-1)| Length = 2249 Score = 28.5 bits (62), Expect = 5.0 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +3 Query: 6 TQNPLSI*PKWSGNSRTVQSGSRTCTKPTTTRRSSKEKRDGTDNQCIIVH 155 T P PK S + T Q +R + TRR ++ DG+D C +++ Sbjct: 452 TPTPAHAKPKPSSGANTAQPRTR---RRVYTRRHHRDHNDGSDTLCALIY 498
>IF1A_YEAST (P38912) Eukaryotic translation initiation factor 1A (EIF-1A)| (EIF-4C) Length = 153 Score = 27.7 bits (60), Expect = 8.5 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 120 RDGTDNQCIIVHQESIDRSTTGKN 191 RD D+QC +VH+ ++D + T KN Sbjct: 82 RDFQDDQCDVVHKYNLDEARTLKN 105
>GLYA_ANASP (Q8YMW8) Serine hydroxymethyltransferase (EC 2.1.2.1) (Serine| methylase) (SHMT) Length = 427 Score = 27.7 bits (60), Expect = 8.5 Identities = 19/53 (35%), Positives = 26/53 (49%) Frame = +3 Query: 30 PKWSGNSRTVQSGSRTCTKPTTTRRSSKEKRDGTDNQCIIVHQESIDRSTTGK 188 P++ G S V +RT TR K DGTDN ++V S+ + TGK Sbjct: 282 PEFQGYSAQVIDNARTLANQLQTR-GLKLVSDGTDNHLMLVDLRSV--NMTGK 331 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,228,052 Number of Sequences: 219361 Number of extensions: 475935 Number of successful extensions: 1195 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1175 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1195 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)