ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart54h10 |
|---|---|
| Clone Library Name | barley_pub |
>PIP1_ATRCA (P42767) Aquaporin PIP-type| Length = 282 Score = 59.3 bits (142), Expect = 4e-09 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKALG 357 WVGPFVGALAAAAYHQY+LRAAAIKALG Sbjct: 247 WVGPFVGALAAAAYHQYVLRAAAIKALG 274
>PIP26_ORYSA (Q7XLR1) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2.6) (OsPIP2.6) Length = 282 Score = 57.8 bits (138), Expect = 1e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKALG 357 W GPF+GALAAAAYHQYILRAAAIKALG Sbjct: 247 WAGPFIGALAAAAYHQYILRAAAIKALG 274
>PIP28_ARATH (Q9ZVX8) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 3b) (PIP3b) Length = 278 Score = 57.4 bits (137), Expect = 2e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKAL 360 WVGPFVGALAAAAYHQYILRAAAIKAL Sbjct: 243 WVGPFVGALAAAAYHQYILRAAAIKAL 269
>PIP27_ARATH (P93004) Aquaporin PIP2.7 (Plasma membrane intrinsic protein 3)| (Salt stress-induced major intrinsic protein) Length = 280 Score = 57.4 bits (137), Expect = 2e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKALG 357 WVGPF+GALAAAAYHQYILRA+AIKALG Sbjct: 245 WVGPFLGALAAAAYHQYILRASAIKALG 272
>PIP21_ORYSA (Q8H5N9) Probable aquaporin PIP2.1 (Plasma membrane intrinsic| protein 2a) (PIP2a) (OsPIP2.1) Length = 290 Score = 52.0 bits (123), Expect = 7e-07 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKALG 357 WVGPFVGA AA YHQYILRA AIKALG Sbjct: 257 WVGPFVGAAIAAFYHQYILRAGAIKALG 284
>PIP24_ARATH (Q9FF53) Probable aquaporin PIP2.4 (Plasma membrane intrinsic| protein 2.4) Length = 291 Score = 51.2 bits (121), Expect = 1e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKALG 357 WVGP +GA AAA YHQ+ILRAAAIKALG Sbjct: 252 WVGPMIGAAAAAFYHQFILRAAAIKALG 279
>PIP25_ARATH (Q9SV31) Probable aquaporin PIP2.5 (Plasma membrane intrinsic| protein 2d) (PIP2d) Length = 286 Score = 48.5 bits (114), Expect = 7e-06 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKALG 357 WVGPF GA AA YHQ++LRA AIKALG Sbjct: 251 WVGPFAGAAIAAFYHQFVLRAGAIKALG 278
>PIP26_ARATH (Q9ZV07) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2e) (PIP2e) Length = 289 Score = 47.0 bits (110), Expect = 2e-05 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKALG 357 WVGPFVGA AA YHQ++LRA A+KA G Sbjct: 251 WVGPFVGAAIAAFYHQFVLRAGAMKAYG 278
>PIP23_ARATH (P30302) Aquaporin PIP2.3 (Plasma membrane intrinsic protein 2c)| (PIP2c) (TMP2C) (RD28-PIP) (Water stress-induced tonoplast intrinsic protein) (WSI-TIP) Length = 285 Score = 45.1 bits (105), Expect = 8e-05 Identities = 18/28 (64%), Positives = 23/28 (82%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKALG 357 WVGPF+GA AA YHQ++LRA+ K+LG Sbjct: 250 WVGPFIGATIAAFYHQFVLRASGSKSLG 277
>PIP22_ARATH (P43287) Aquaporin PIP2.2 (Plasma membrane intrinsic protein 2b)| (PIP2b) (TMP2b) Length = 285 Score = 45.1 bits (105), Expect = 8e-05 Identities = 18/28 (64%), Positives = 23/28 (82%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKALG 357 WVGPF+GA AA YHQ++LRA+ K+LG Sbjct: 250 WVGPFIGAAIAAFYHQFVLRASGSKSLG 277
>PIP21_ARATH (P43286) Aquaporin PIP2.1 (Plasma membrane intrinsic protein 2a)| (PIP2a) Length = 287 Score = 45.1 bits (105), Expect = 8e-05 Identities = 18/28 (64%), Positives = 23/28 (82%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKALG 357 WVGPF+GA AA YHQ++LRA+ K+LG Sbjct: 252 WVGPFIGAAIAAFYHQFVLRASGSKSLG 279
>PIP22_ORYSA (Q6K215) Probable aquaporin PIP2.2 (Plasma membrane intrinsic| protein 2.2) (OsPIP2.2) Length = 288 Score = 44.3 bits (103), Expect = 1e-04 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIK 366 WVGP +GA AAAYHQY+LRA+A K Sbjct: 256 WVGPLIGAAIAAAYHQYVLRASAAK 280
>PIP23_ORYSA (Q7XUA6) Probable aquaporin PIP2.3 (Plasma membrane intrinsic| protein 2.3) (OsPIP2.3) Length = 290 Score = 44.3 bits (103), Expect = 1e-04 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIK 366 WVGP +GA AAAYHQY+LRA+A K Sbjct: 257 WVGPLIGAAIAAAYHQYVLRASAAK 281
>PIP28_ORYSA (Q7Y1E6) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 2.8) (OsPIP2.8) Length = 280 Score = 43.1 bits (100), Expect = 3e-04 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKA 363 WVGPF GA AA YH YILR AA KA Sbjct: 244 WVGPFAGAAAAMIYHHYILRGAAAKA 269
>PIP24_ORYSA (Q8GRT8) Aquaporin PIP2.4 (Plasma membrane intrinsic protein 2.4)| (OsPIP2.4) Length = 286 Score = 40.4 bits (93), Expect = 0.002 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAA 372 WVGPF+GA AA YHQ ILRA+A Sbjct: 254 WVGPFIGAAIAALYHQVILRASA 276
>PIP27_ORYSA (Q651D5) Probable aquaporin PIP2.7 (Plasma membrane intrinsic| protein 2.7) (OsPIP2.7) Length = 290 Score = 40.4 bits (93), Expect = 0.002 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKAL 360 WVGP +GA AAAYH+ +LR A KAL Sbjct: 254 WVGPVIGAFLAAAYHKLVLRGEAAKAL 280
>PIP25_ORYSA (Q8GRI8) Aquaporin PIP2.5 (Plasma membrane intrinsic protein 2.5)| (OsPIP2.5) Length = 283 Score = 40.0 bits (92), Expect = 0.003 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAA 372 WVGPF+GA AA YHQ +LRA+A Sbjct: 251 WVGPFIGAAIAALYHQIVLRASA 273
>PIP11_ORYSA (Q6EU94) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (OsPIP1.1) (Water channel protein RWC1) (RWC-1) Length = 289 Score = 39.7 bits (91), Expect = 0.003 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKA 363 WVGPFVGA AA YHQ I+RA K+ Sbjct: 262 WVGPFVGAALAAIYHQVIIRAIPFKS 287
>PIP2_PEA (P25794) Probable aquaporin PIP-type 7a (Turgor-responsive protein| 7a) (Turgor-responsive protein 31) Length = 289 Score = 38.9 bits (89), Expect = 0.006 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKA 363 WVGPF+GA AA YHQ ++RA K+ Sbjct: 263 WVGPFIGAALAALYHQVVIRAIPFKS 288
>PIP12_ORYSA (Q7XSQ9) Probable aquaporin PIP1.2 (Plasma membrane intrinsic| protein 1.2) (OsPIP1.2) Length = 282 Score = 38.9 bits (89), Expect = 0.006 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKA 363 WVGPF+GA AA YHQ ++RA K+ Sbjct: 255 WVGPFIGAALAAIYHQVVIRAIPFKS 280
>PIP15_ARATH (Q8LAA6) Probable aquaporin PIP1.5 (Plasma membrane intrinsic| protein 1d) (PIP1d) Length = 287 Score = 38.9 bits (89), Expect = 0.006 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKA 363 WVGPF+GA AA YHQ ++RA K+ Sbjct: 260 WVGPFIGAALAALYHQIVIRAIPFKS 285
>PIP14_ARATH (Q39196) Probable aquaporin PIP1.4 (Plasma membrane intrinsic| protein 1.4) (Transmembrane protein C) (TMP-C) Length = 287 Score = 38.9 bits (89), Expect = 0.006 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKA 363 WVGPF+GA AA YHQ ++RA K+ Sbjct: 260 WVGPFIGAALAALYHQIVIRAIPFKS 285
>PIP13_ARATH (Q08733) Aquaporin PIP1.3 (Plasma membrane intrinsic protein 1c)| (PIP1c) (Transmembrane protein B) (TMP-B) Length = 286 Score = 38.9 bits (89), Expect = 0.006 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKA 363 WVGPF+GA AA YHQ ++RA K+ Sbjct: 259 WVGPFIGAALAALYHQLVIRAIPFKS 284
>PIP13_ORYSA (Q9SXF8) Aquaporin PIP 1.3 (Plasma membrane intrinsic protein 1.3)| (OsPIP1.3) (Water channel protein RWC3) (RWC-3) Length = 288 Score = 36.2 bits (82), Expect = 0.037 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKA 363 WVGPF+GA AA YH ++RA K+ Sbjct: 261 WVGPFIGAALAAIYHVVVIRAIPFKS 286
>PIP12_ARATH (Q06611) Aquaporin PIP1.2 (Plasma membrane intrinsic protein 1b)| (PIP1b) (Transmembrane protein A) (TMP-A) (AthH2) Length = 286 Score = 36.2 bits (82), Expect = 0.037 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKA 363 WVGPF+GA AA YH ++RA K+ Sbjct: 259 WVGPFIGAALAALYHVIVIRAIPFKS 284
>PIP11_VICFA (P61838) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 36.2 bits (82), Expect = 0.037 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKA 363 WVGPF+GA AA YH ++RA K+ Sbjct: 259 WVGPFIGAALAALYHVVVIRAIPFKS 284
>PIP11_ARATH (P61837) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 36.2 bits (82), Expect = 0.037 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRAAAIKA 363 WVGPF+GA AA YH ++RA K+ Sbjct: 259 WVGPFIGAALAALYHVVVIRAIPFKS 284
>PIP1_LYCES (Q08451) Probable aquaporin PIP-type pTOM75 (Ripening-associated| membrane protein) (RAMP) Length = 286 Score = 35.4 bits (80), Expect = 0.063 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYILRA 378 WVGP +GA AA YHQ I+RA Sbjct: 260 WVGPMIGAALAAIYHQIIIRA 280
>SMYD4_PONPY (Q5R5X9) SET and MYND domain-containing protein 4| Length = 804 Score = 30.8 bits (68), Expect = 1.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 293 YCHRCIKLLAGVLSCSGCS 349 YCHRC+K + C GCS Sbjct: 295 YCHRCLKHTLATVPCDGCS 313
>SMYD4_HUMAN (Q8IYR2) SET and MYND domain-containing protein 4| Length = 804 Score = 30.8 bits (68), Expect = 1.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 293 YCHRCIKLLAGVLSCSGCS 349 YCHRC+K + C GCS Sbjct: 295 YCHRCLKHTLATVPCDGCS 313
>SMYD4_CHICK (Q5F3V0) SET and MYND domain-containing protein 4| Length = 742 Score = 30.4 bits (67), Expect = 2.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 293 YCHRCIKLLAGVLSCSGCS 349 YCH C+K L + C GCS Sbjct: 294 YCHHCLKQLLASIPCCGCS 312
>UBR1_CAEEL (P91133) Ubiquitin-protein ligase E3 component N-recognin (EC| 6.-.-.-) (Ubiquitin-protein ligase E3-alpha) Length = 1927 Score = 29.6 bits (65), Expect = 3.5 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -1 Query: 351 PEQPEQLSTPANNLMQRWQYCSSCPSGAS*PHKRTGFVLAVLLLHRAHP 205 P +P+ TP + L+ S P+ A PH T F V L + A P Sbjct: 1560 PPRPKLAQTPGSPLLSAPSTSSFTPAPAQIPHSGTNFAFLVQLFNPAGP 1608
>CATA_BACST (P14412) Peroxidase/catalase (EC 1.11.1.6) (Catalase-peroxidase)| Length = 735 Score = 28.9 bits (63), Expect = 5.9 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +3 Query: 153 WWPLSLSLTCMHRH*TRPDGHD 218 WWP L+L+ +H+H + + HD Sbjct: 31 WWPNQLNLSILHQHDRKTNPHD 52
>TELT_MOUSE (O70548) Telethonin (Titin cap protein)| Length = 167 Score = 28.5 bits (62), Expect = 7.7 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +2 Query: 188 QTLNEAGWARWRSSTANTKPVRLCG*LAPDGHEEQYCHR 304 Q EA WA W+ T +T+P C D + HR Sbjct: 15 QERREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHR 53
>SMYD4_MOUSE (Q8BTK5) SET and MYND domain-containing protein 4| Length = 799 Score = 28.5 bits (62), Expect = 7.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 293 YCHRCIKLLAGVLSCSGCS 349 YCHRC+K + C CS Sbjct: 295 YCHRCLKHTLATVPCGSCS 313
>AQP2_SHEEP (O62735) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 28.5 bits (62), Expect = 7.7 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYIL 384 W+GP VGA+ A+ + Y+L Sbjct: 205 WIGPLVGAIVASLLYNYVL 223
>AQP4_RAT (P47863) Aquaporin-4 (AQP-4) (WCH4) (Mercurial-insensitive water| channel) (MIWC) Length = 323 Score = 28.5 bits (62), Expect = 7.7 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -2 Query: 440 WVGPFVGALAAAAYHQYI 387 WVGP +GA+ A A ++Y+ Sbjct: 234 WVGPIIGAVLAGALYEYV 251 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,315,749 Number of Sequences: 219361 Number of extensions: 1011250 Number of successful extensions: 2493 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 2424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2492 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
