ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart54h06 |
|---|---|
| Clone Library Name | barley_pub |
>VSPA_SOYBN (P15490) Stem 28 kDa glycoprotein precursor (Vegetative storage| protein A) Length = 254 Score = 59.7 bits (143), Expect = 2e-09 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -3 Query: 353 KSGERQKLQDAGYVIVGNIGDQWSDILGAPEG-ARTFKLPDPMYYI 219 K+ R+KL GY IVG IGDQWSD+LG G +RTFKLP+P+YYI Sbjct: 208 KTAAREKLIRQGYNIVGIIGDQWSDLLGGHRGESRTFKLPNPLYYI 253
>VSPB_SOYBN (P10743) Stem 31 kDa glycoprotein precursor (Vegetative storage| protein B) Length = 254 Score = 59.3 bits (142), Expect = 2e-09 Identities = 30/46 (65%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = -3 Query: 353 KSGERQKLQDAGYVIVGNIGDQWSDILGAPEG-ARTFKLPDPMYYI 219 KS R+ L GY IVG IGDQWSD+LG G +RTFKLP+PMYYI Sbjct: 208 KSAMRENLLRQGYRIVGIIGDQWSDLLGDHRGESRTFKLPNPMYYI 253
>PPA1_LYCES (P27061) Acid phosphatase 1 precursor (EC 3.1.3.2) (Apase-1(1))| Length = 255 Score = 58.9 bits (141), Expect = 3e-09 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = -3 Query: 353 KSGERQKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPMYYI 219 KS R + + G+ IVGN GDQWSD+LG+ R+FKLP+PMYYI Sbjct: 210 KSERRNAMVEEGFRIVGNSGDQWSDLLGSSMSYRSFKLPNPMYYI 254
>VSP2_ARATH (O82122) Vegetative storage protein 2 precursor| Length = 265 Score = 52.8 bits (125), Expect = 2e-07 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = -3 Query: 353 KSGERQKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPMYYI 219 KS R+ L GY IVGNIGDQW+D++ G R FKLP+P+YY+ Sbjct: 220 KSKVRKSLVKKGYNIVGNIGDQWADLVEDTPG-RVFKLPNPLYYV 263
>VSP1_ARATH (O49195) Vegetative storage protein 1 precursor| Length = 270 Score = 52.4 bits (124), Expect = 3e-07 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = -3 Query: 353 KSGERQKLQDAGYVIVGNIGDQWSDILGAPEGARTFKLPDPMYYI 219 KS R L GY IVGNIGDQW+D++ G R FKLP+P+YY+ Sbjct: 225 KSKVRNSLVKKGYNIVGNIGDQWADLVEDTPG-RVFKLPNPLYYV 268
>S25K_SOYBN (P10742) Stem 31 kDa glycoprotein precursor (Vegetative storage| protein VSP25) (Fragment) Length = 291 Score = 52.0 bits (123), Expect = 4e-07 Identities = 26/42 (61%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 353 KSGERQKLQDAGYVIVGNIGDQWSDILGAPEG-ARTFKLPDP 231 K+ R+KL GY IVG IGDQWSD+LG G +RTFKLP+P Sbjct: 205 KTAAREKLIRQGYNIVGIIGDQWSDLLGGHRGESRTFKLPNP 246
>AAD6_YEAST (P43547) Putative aryl-alcohol dehydrogenase AAD6 (EC 1.1.1.-)| Length = 212 Score = 30.8 bits (68), Expect = 0.86 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 302 NIGDQWSDILGAPEGARTFKLPDPMY 225 +IGD WS+ILG+ R F+L D Y Sbjct: 38 SIGDAWSEILGSMSKERAFELLDAFY 63
>CTR9_YEAST (P89105) Protein CTR9| Length = 1077 Score = 29.3 bits (64), Expect = 2.5 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 246 QAARPHVLHRLGRLWFGRA 190 + RPH+L+ LGR W+ RA Sbjct: 764 EKTRPHILNLLGRAWYARA 782
>FLGH_BRUSU (Q8FXC2) Flagellar L-ring protein precursor (Basal body L-ring| protein) Length = 238 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +3 Query: 186 SMPGRTRGGLADV---VHGVGQLEGAGTLWRAEDVAPLVADVTDDDIP 320 S+ G GG D H + +G GT+ R+ED+ +A + D +P Sbjct: 116 SITGAAAGGDMDASINTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLP 163
>FLGH_BRUME (Q8YB19) Flagellar L-ring protein precursor (Basal body L-ring| protein) Length = 238 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +3 Query: 186 SMPGRTRGGLADV---VHGVGQLEGAGTLWRAEDVAPLVADVTDDDIP 320 S+ G GG D H + +G GT+ R+ED+ +A + D +P Sbjct: 116 SITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLP 163
>FLGH_BRUAB (Q579T6) Flagellar L-ring protein precursor (Basal body L-ring| protein) Length = 238 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +3 Query: 186 SMPGRTRGGLADV---VHGVGQLEGAGTLWRAEDVAPLVADVTDDDIP 320 S+ G GG D H + +G GT+ R+ED+ +A + D +P Sbjct: 116 SITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAAIVTDTLP 163
>YG2K_YEAST (P53253) Protein YGR089W| Length = 936 Score = 27.7 bits (60), Expect = 7.3 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +3 Query: 3 QHNKD-PLIKTHATSPLTRLIHSSN*SQALNNGNEPSNNWGLI 128 +H+KD I TH+ S H+ +++ N EPSN LI Sbjct: 532 KHDKDLDTINTHSVSSRISFTHAGKFKKSVFNNFEPSNTMALI 574
>RC3H1_HUMAN (Q5TC82) Roquin (RING finger and C3H zinc finger protein 1)| Length = 1133 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 226 YMGSGSLKVRAPSGAPRMSLHWSPMLPTMTY 318 Y G+G ++ AP GAP S++ S P T+ Sbjct: 890 YQGAGPMQAMAPQGAPTKSINISDYSPYGTH 920
>YBI1_YEAST (P38180) Hypothetical 40.8 kDa protein in RHK1-PET112 intergenic| region Length = 368 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +3 Query: 3 QHNKDPLIKTHATSPLTRLIHSSN*SQALNNGNEPSNN 116 Q+ +P++ H +L ++SN + NN N +NN Sbjct: 134 QYTSNPMVTAHLKQTYPQLYYNSNVNAHNNNNNSNNNN 171 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,555,847 Number of Sequences: 219361 Number of extensions: 808078 Number of successful extensions: 2143 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2138 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
