Clone Name | rbart54f12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YKY1_SCHPO (O13796) Hypothetical protein C1142.01 in chromosome I | 28 | 5.1 | 2 | SDK1_CHICK (Q8AV58) Protein sidekick-1 precursor | 28 | 6.7 | 3 | NU5M_LOCMI (Q36428) NADH-ubiquinone oxidoreductase chain 5 (EC 1... | 28 | 6.7 |
---|
>YKY1_SCHPO (O13796) Hypothetical protein C1142.01 in chromosome I| Length = 667 Score = 28.5 bits (62), Expect = 5.1 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 7 PVVEQADPEVATNKRKSNTTKSPKKFAKSQREGNKE 114 P+VE P V+TNK+ N K K+ K + G ++ Sbjct: 81 PLVEGESPIVSTNKKAKNKKKKKKQQKKKKVTGKRD 116
>SDK1_CHICK (Q8AV58) Protein sidekick-1 precursor| Length = 2169 Score = 28.1 bits (61), Expect = 6.7 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = -2 Query: 103 LPAGTWQTFSETLLYYSFSCLLQ 35 LP G WQT+S ++ + + SC+++ Sbjct: 1471 LPNGDWQTYSSSISHEATSCIIE 1493
>NU5M_LOCMI (Q36428) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 572 Score = 28.1 bits (61), Expect = 6.7 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 Query: 139 WSRFNIFMFLYYLPAGTWQTFSETLLYYSFS 47 W F IF FLY+ G ++S L YYS S Sbjct: 370 WVNFFIF-FLYFFSTGLTASYSFRLFYYSMS 399 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.128 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,749,287 Number of Sequences: 219361 Number of extensions: 380663 Number of successful extensions: 1094 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1081 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1094 length of database: 80,573,946 effective HSP length: 38 effective length of database: 72,238,228 effective search space used: 1733717472 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)