Clone Name | rbart54e02 |
---|---|
Clone Library Name | barley_pub |
>YANB_SCHPO (Q10076) Hypothetical zinc finger protein C3H1.11 in chromosome I| Length = 582 Score = 32.0 bits (71), Expect = 0.93 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -1 Query: 343 PSVYSGDFSPAQRGNPAGSADCSHWCLPGLPDTWN 239 P V + F+PAQ +P S C + LP P T N Sbjct: 19 PQVNTSPFAPAQSSSPLPSNSCREYSLPSHPSTHN 53
>CD14_HUMAN (P08571) Monocyte differentiation antigen CD14 precursor (Myeloid| cell-specific leucine-rich glycoprotein) [Contains: Monocyte differentiation antigen CD14, urinary form; Monocyte differentiation antigen CD14, membrane-bound form] Length = 375 Score = 30.0 bits (66), Expect = 3.5 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +1 Query: 22 SLRLQHTMWATG--WHSEVVQPHQPRLHILLAQRIHS 126 SLRL++ WATG W +E+ Q +P L +L + HS Sbjct: 146 SLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHS 182
>FRAS1_HUMAN (Q86XX4) Extracellular matrix protein FRAS1 precursor| Length = 4007 Score = 30.0 bits (66), Expect = 3.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 116 RCASSICRRG**GCTTSECQPV 51 RCA +CR G C T++CQP+ Sbjct: 176 RCAKCLCRNGVAQCFTAQCQPL 197
>NHLC1_HUMAN (Q6VVB1) NHL repeat-containing protein 1 (Malin)| Length = 395 Score = 30.0 bits (66), Expect = 3.5 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 98 CRRG**GCTTSECQPVAHIV 39 CRR GC TS+C PV H++ Sbjct: 71 CRRACRGCDTSDCLPVLHLI 90
>MLL2_HUMAN (O14686) Myeloid/lymphoid or mixed-lineage leukemia protein 2| (ALL1-related protein) Length = 5262 Score = 29.3 bits (64), Expect = 6.0 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = -1 Query: 319 SPAQRGNPAGSADCSHWCLPGLPDTWNQ 236 +PA G P GS HWC W Q Sbjct: 125 TPAHLGEPGGSCWAHHWCAAWSAGVWGQ 152 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,328,535 Number of Sequences: 219361 Number of extensions: 1075894 Number of successful extensions: 3230 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3230 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)