| Clone Name | rbart54d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AGRN_RAT (P25304) Agrin precursor | 32 | 0.47 | 2 | YQJG_ECOLI (P42620) Hypothetical protein yqjG | 32 | 0.61 | 3 | TRI2_STRCO (Q9RKB9) Putative tricorn protease homolog 2 (EC 3.4.... | 29 | 4.0 | 4 | SMC3_YEAST (P47037) Structural maintenance of chromosome 3 (DA-b... | 28 | 8.8 | 5 | YM85_YEAST (Q04806) Hypothetical 42.4 kDa protein in FAA4-HOR7 i... | 28 | 8.8 |
|---|
>AGRN_RAT (P25304) Agrin precursor| Length = 1959 Score = 32.0 bits (71), Expect = 0.47 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = -3 Query: 175 PPVHQPLRDHPPRPQHRLQCSP*QREAVPVIFKKTPFCSCA*GCCGFRLPVSGAESL 5 PP HQ D P P H +QC+ AV + C C C G PV G++ + Sbjct: 349 PPKHQGPCDQTPSPCHGVQCA---FGAVCTVKNGKAECECQRVCSGIYDPVCGSDGV 402
>YQJG_ECOLI (P42620) Hypothetical protein yqjG| Length = 328 Score = 31.6 bits (70), Expect = 0.61 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -1 Query: 177 SHPSINPYGIIPQGPNIDYNAPHDRERLF 91 SH +INP GII GP D + PH R+ F Sbjct: 299 SHKTINPTGIISIGPWQDLDEPHGRDVRF 327
>TRI2_STRCO (Q9RKB9) Putative tricorn protease homolog 2 (EC 3.4.21.-)| Length = 1171 Score = 28.9 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 3 IRLSAPDTGKRKPQHPQAHEQNGVFLKITGTAS 101 +RLS P G+R Q P A G+ + TG AS Sbjct: 280 VRLSGPRAGRRTHQVPAAQHVGGISVDETGRAS 312
>SMC3_YEAST (P47037) Structural maintenance of chromosome 3 (DA-box protein| SMC3) Length = 1230 Score = 27.7 bits (60), Expect = 8.8 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -1 Query: 162 NPYGIIPQGPNIDYNAPHDRERLFL 88 NPY I+PQG + D+ERL L Sbjct: 141 NPYNIVPQGKIVALTNAKDKERLQL 165
>YM85_YEAST (Q04806) Hypothetical 42.4 kDa protein in FAA4-HOR7 intergenic| region Length = 366 Score = 27.7 bits (60), Expect = 8.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 177 SHPSINPYGIIPQGPNIDYNAP 112 S P +NP GI P GP D P Sbjct: 345 SQPRVNPIGITPLGPKPDIRPP 366 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,792,495 Number of Sequences: 219361 Number of extensions: 494113 Number of successful extensions: 1818 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1817 length of database: 80,573,946 effective HSP length: 34 effective length of database: 73,115,672 effective search space used: 1754776128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)