Clone Name | rbart54d11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | C72A1_CATRO (Q05047) Cytochrome P450 72A1 (EC 1.3.3.9) (CYPLXXII... | 41 | 7e-04 | 2 | SYT_FRATT (Q5NGL8) Threonyl-tRNA synthetase (EC 6.1.1.3) (Threon... | 28 | 6.4 |
---|
>C72A1_CATRO (Q05047) Cytochrome P450 72A1 (EC 1.3.3.9) (CYPLXXII) (Secologanin| synthase) (SLS) Length = 524 Score = 41.2 bits (95), Expect = 7e-04 Identities = 16/33 (48%), Positives = 24/33 (72%) Frame = -3 Query: 219 FSFSLSPRYVHAPMDVITLRPKFGLPMILKSLE 121 F F ++P YVHAP ++T++P+FG +I K LE Sbjct: 491 FKFDVAPSYVHAPFTILTVQPQFGSHVIYKKLE 523
>SYT_FRATT (Q5NGL8) Threonyl-tRNA synthetase (EC 6.1.1.3) (Threonine--tRNA| ligase) (ThrRS) Length = 634 Score = 28.1 bits (61), Expect = 6.4 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +1 Query: 52 QNHPFAIRPINKQPCV-VLNTPLH 120 +N FAIRP+N CV V NT LH Sbjct: 321 ENRDFAIRPMNCPTCVQVYNTKLH 344 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,582,854 Number of Sequences: 219361 Number of extensions: 622010 Number of successful extensions: 1527 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1527 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)