Clone Name | rbart54d09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | JI60_HORVU (Q00531) 60 kDa jasmonate-induced protein (EC 3.2.2.2... | 46 | 2e-05 | 2 | GNMT_HUMAN (Q14749) Glycine N-methyltransferase (EC 2.1.1.20) | 29 | 3.9 | 3 | ATR_ORYSA (Q5Z987) Serine/threonine-protein kinase ATR (EC 2.7.1... | 28 | 6.7 | 4 | CS007_MOUSE (Q6ZPZ3) Zinc finger CCCH-type domain-containing pro... | 28 | 6.7 |
---|
>JI60_HORVU (Q00531) 60 kDa jasmonate-induced protein (EC 3.2.2.22) (rRNA| N-glycosidase) Length = 560 Score = 46.2 bits (108), Expect = 2e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -2 Query: 191 VGVNDAEFEVTILWSEYPW 135 VGVNDAEFEVTILWSEYPW Sbjct: 542 VGVNDAEFEVTILWSEYPW 560
>GNMT_HUMAN (Q14749) Glycine N-methyltransferase (EC 2.1.1.20)| Length = 294 Score = 28.9 bits (63), Expect = 3.9 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +1 Query: 1 PLFITNILENTNWYVSRKDTYFSTRTEFHIVFVVDSSPLAHMGVYQG-YSDHKIVTSNSA 177 P F ++E NW KD S F V + +S AH+ +G S+H++ N A Sbjct: 105 PAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNS-FAHLPDCKGDQSEHRLALKNIA 163 Query: 178 SL 183 S+ Sbjct: 164 SM 165
>ATR_ORYSA (Q5Z987) Serine/threonine-protein kinase ATR (EC 2.7.11.1)| Length = 2710 Score = 28.1 bits (61), Expect = 6.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -1 Query: 189 WCQ*C*IRGDNLMVGVPLVDTHVSERTTINYKYYM 85 WC C +R ++ VP+VD +SE I++K M Sbjct: 734 WCPQCDVRTVHIEDQVPIVDIALSEDKNIDFKINM 768
>CS007_MOUSE (Q6ZPZ3) Zinc finger CCCH-type domain-containing protein C19orf7| homolog Length = 1304 Score = 28.1 bits (61), Expect = 6.7 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 151 GRSTLGRHPCERADYYQLQILYGTQYE 71 GR ++G HP + D Y+ +I YG E Sbjct: 269 GRGSMGEHPEDEEDLYEEEIEYGESEE 295 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,466,331 Number of Sequences: 219361 Number of extensions: 395187 Number of successful extensions: 1055 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1045 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1055 length of database: 80,573,946 effective HSP length: 39 effective length of database: 72,018,867 effective search space used: 1728452808 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)