>TNR19_MOUSE (Q9JLL3) Tumor necrosis factor receptor superfamily member 19|
           precursor (Toxicity and JNK inducer) (TRADE)
          Length = 416

 Score = 30.0 bits (66), Expect = 1.6
 Identities = 13/32 (40%), Positives = 22/32 (68%), Gaps = 1/32 (3%)
 Frame = -2

Query: 251 LVGTFRKANCSHTCNSIL-QCIPVCIRQSMLL 159
           LV  F++ANCSHT +++   C+P   R++ L+
Sbjct: 97  LVNRFQRANCSHTSDAVCGDCLPGFYRKTKLV 128


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 36,109,170
Number of Sequences: 219361
Number of extensions: 575825
Number of successful extensions: 1184
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1171
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1184
length of database: 80,573,946
effective HSP length: 61
effective length of database: 67,192,925
effective search space used: 1612630200
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)