Clone Name | rbart54d07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | R1AB_BSCR3 (Q3I5J6) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [... | 31 | 0.93 | 2 | R1AB_CVHSA (P59641) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [... | 31 | 0.93 | 3 | WNK4_HUMAN (Q96J92) Serine/threonine-protein kinase WNK4 (EC 2.7... | 31 | 0.93 |
---|
>R1AB_BSCR3 (Q3I5J6) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [Includes:| Replicase polyprotein 1a (pp1a) (ORF1A)] [Contains: Leader protein; p65 homolog; NSP1 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); 3C-like proteinase (EC 3.4.22.-) (3CL-PRO) (3 Length = 7071 Score = 30.8 bits (68), Expect = 0.93 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -1 Query: 268 DEKGHLLDNYGIIKCYAICNGCHRYRISSRIFDMPCCNVTFF 143 DE+G+LLD+Y ++K + + N H I + + D P V F Sbjct: 4427 DEEGNLLDSYFVVKRHTMSNYQHEETIYNLVKDCPAVAVHDF 4468
>R1AB_CVHSA (P59641) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [Includes:| Replicase polyprotein 1a (pp1a) (ORF1A)] [Contains: Leader protein; p65 homolog; NSP1 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); 3C-like proteinase (EC 3.4.22.-) (3CL-PRO) (3 Length = 7073 Score = 30.8 bits (68), Expect = 0.93 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -1 Query: 268 DEKGHLLDNYGIIKCYAICNGCHRYRISSRIFDMPCCNVTFF 143 DE+G+LLD+Y ++K + + N H I + + D P V F Sbjct: 4429 DEEGNLLDSYFVVKRHTMSNYQHEETIYNLVKDCPAVAVHDF 4470
>WNK4_HUMAN (Q96J92) Serine/threonine-protein kinase WNK4 (EC 2.7.11.1)| (Protein kinase with no lysine 4) (Protein kinase, lysine-deficient 4) Length = 1243 Score = 30.8 bits (68), Expect = 0.93 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +3 Query: 3 CSEITLQNTKHYIPQCPGLSSIM*TVALELLSLAT 107 CS++TL + + P CP SS T A LLSLA+ Sbjct: 896 CSQVTLSSP--FFPPCPSTSSFPSTTAAPLLSLAS 928 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,673,662 Number of Sequences: 219361 Number of extensions: 667320 Number of successful extensions: 1400 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1400 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)