Clone Name | rbart54d01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BUB1_HUMAN (O43683) Mitotic checkpoint serine/threonine-protein ... | 29 | 2.9 | 2 | GRID1_RAT (Q62640) Glutamate receptor delta-1 subunit precursor ... | 28 | 8.4 | 3 | GRID1_MOUSE (Q61627) Glutamate receptor delta-1 subunit precurso... | 28 | 8.4 | 4 | GRID1_HUMAN (Q9ULK0) Glutamate receptor delta-1 subunit precurso... | 28 | 8.4 |
---|
>BUB1_HUMAN (O43683) Mitotic checkpoint serine/threonine-protein kinase BUB1 (EC| 2.7.11.1) (hBUB1) (BUB1A) Length = 1085 Score = 29.3 bits (64), Expect = 2.9 Identities = 15/45 (33%), Positives = 18/45 (40%) Frame = +3 Query: 39 CSPRGLFSHPPVSSLW*PGILIQQSNGFQHITYTNPDCNIYEELD 173 C P GLF P +W N F H+ PDC+ LD Sbjct: 1013 CKPEGLFRRLPHLDMW---------NEFFHVMLNIPDCHHLPSLD 1048
>GRID1_RAT (Q62640) Glutamate receptor delta-1 subunit precursor (GluR| delta-1) Length = 1009 Score = 27.7 bits (60), Expect = 8.4 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -2 Query: 221 GILRNDPQN*LCVESVVQFFIDVAVWICISYVLKAVGLL 105 GIL P+ + + S+ F D AVW CI+ + VG+L Sbjct: 542 GILIKKPEEKISIFSLFAPF-DFAVWACIAAAIPVVGVL 579
>GRID1_MOUSE (Q61627) Glutamate receptor delta-1 subunit precursor (GluR| delta-1) Length = 1009 Score = 27.7 bits (60), Expect = 8.4 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -2 Query: 221 GILRNDPQN*LCVESVVQFFIDVAVWICISYVLKAVGLL 105 GIL P+ + + S+ F D AVW CI+ + VG+L Sbjct: 542 GILIKKPEEKISIFSLFAPF-DFAVWACIAAAIPVVGVL 579
>GRID1_HUMAN (Q9ULK0) Glutamate receptor delta-1 subunit precursor (GluR| delta-1) Length = 1009 Score = 27.7 bits (60), Expect = 8.4 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -2 Query: 221 GILRNDPQN*LCVESVVQFFIDVAVWICISYVLKAVGLL 105 GIL P+ + + S+ F D AVW CI+ + VG+L Sbjct: 542 GILIKKPEEKISIFSLFAPF-DFAVWACIAAAIPVVGVL 579 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,879,729 Number of Sequences: 219361 Number of extensions: 591860 Number of successful extensions: 1303 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1274 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1303 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)