Clone Name | rbart54b04 |
---|---|
Clone Library Name | barley_pub |
>GIDA_XANCP (Q8PDG1) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gidA (Glucose-inhibited division protein A) Length = 634 Score = 30.8 bits (68), Expect = 2.0 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +3 Query: 375 TELSCWLVGSTEEDDD-*RWPSYLAVLDDGAVEGVGP 482 T++SCW+ +TE+ D R + + L G +EG+GP Sbjct: 244 TQVSCWITHTTEQTHDIIRGALHRSPLYSGQIEGIGP 280
>GIDA_XANC8 (Q4UZP9) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gidA (Glucose-inhibited division protein A) Length = 634 Score = 30.8 bits (68), Expect = 2.0 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +3 Query: 375 TELSCWLVGSTEEDDD-*RWPSYLAVLDDGAVEGVGP 482 T++SCW+ +TE+ D R + + L G +EG+GP Sbjct: 244 TQVSCWITHTTEQTHDIIRGALHRSPLYSGQIEGIGP 280
>YADC_SCHPO (Q09837) Putative glycosyl transferase C4G8.12c in chromosome I (EC| 2.-.-.-) Length = 533 Score = 30.0 bits (66), Expect = 3.5 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -1 Query: 193 FRLCGCICRMQCQPSTNM*LHALYPFMKHDRIYVLLL 83 F LC CIC+ C P YP + R+Y+ L+ Sbjct: 75 FLLCRCICKSNCSP---------YPILLFTRLYMCLI 102
>ECM17_YEAST (P47169) Sulfite reductase [NADPH] beta subunit (EC 1.8.1.2)| (Extracellular matrix protein 17) Length = 1442 Score = 30.0 bits (66), Expect = 3.5 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = +3 Query: 354 LIKTPAKTELSCWLVGSTEEDDD*RWPSYLAVLDDG 461 L KT A E+ WL G E+DDD WPS DG Sbjct: 1013 LPKTTAYHEV--WLEGPEEQDDDPSWPSIFENRKDG 1046
>ITB8_HUMAN (P26012) Integrin beta-8 precursor| Length = 769 Score = 29.6 bits (65), Expect = 4.5 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 123 YRACSYIFVEGWHCMRQMHPQSLKQSI 203 Y AC E W+CM+ +HP +L Q+I Sbjct: 631 YTACK----ENWNCMQCLHPHNLSQAI 653
>RFL1_ARATH (Q8L3R3) Disease resistance protein RFL1 (RPS5-like protein 1)| (pNd13/pNd14) Length = 885 Score = 25.0 bits (53), Expect(2) = 9.2 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -2 Query: 198 IVSDFADASAACNANPLRICNCMLC 124 I + F D + CNA R+C C C Sbjct: 82 IENQFNDLLSTCNAEIQRLCLCGFC 106 Score = 21.9 bits (45), Expect(2) = 9.2 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -3 Query: 407 RRTNQPARELCFGGSFNQSIN*FLWEIEEA 318 R NQ ++ LC GS+ Q+++ L +++A Sbjct: 13 REVNQFSQWLCVSGSYIQNLSENLASLQKA 42 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,281,454 Number of Sequences: 219361 Number of extensions: 1219762 Number of successful extensions: 2307 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2307 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)