Clone Name | rbart54a12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TRMB_FUSNN (Q8R6G8) Bifunctional glycosyltransferase/methyltrans... | 28 | 5.2 | 2 | PMP11_CHLPN (O86164) Probable outer membrane protein pmp11 precu... | 27 | 8.8 |
---|
>TRMB_FUSNN (Q8R6G8) Bifunctional glycosyltransferase/methyltransferase| [Includes: KdtA protein homolog (EC 2.-.-.-); tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA(m7G46)-methyltransferase)] Length = 640 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 57 IEEAAADLFIHFFHLIKRNYS 119 I+E A DL+ HFFH K NY+ Sbjct: 410 IKEEAKDLWKHFFHSEKSNYN 430
>PMP11_CHLPN (O86164) Probable outer membrane protein pmp11 precursor (Polymorphic| membrane protein 11) (Outer membrane protein 4) Length = 928 Score = 27.3 bits (59), Expect = 8.8 Identities = 25/91 (27%), Positives = 37/91 (40%), Gaps = 9/91 (9%) Frame = -2 Query: 371 QSSSVDGRTDGLAFSFLPLANLSVTLFLTF-----GDAKFLDDARM----MKKNCGQETG 219 Q+S + +DG FS L NLS+ + F GD+ D + + +N Q T Sbjct: 807 QNSFFESSSDGRGFSIGRLLNLSIPVGAKFVQGDIGDSYTYDLSGFFVSDVYRNNPQSTA 866 Query: 218 XXXXXXXXXXXERKNISRKKKLARGSRRNIY 126 N+SR+ L RGS +Y Sbjct: 867 TLVMSPDSWKIRGGNLSRQAFLLRGSNNYVY 897 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,720,295 Number of Sequences: 219361 Number of extensions: 902857 Number of successful extensions: 1759 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1759 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)