Clone Name | rbart53h09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CHIA_HUMAN (Q9BZP6) Acidic mammalian chitinase precursor (EC 3.2... | 28 | 4.6 | 2 | NUCM_TRYBB (P21301) NADH-ubiquinone oxidoreductase 49 kDa subuni... | 28 | 6.0 | 3 | IL9R_HUMAN (Q01113) Interleukin-9 receptor precursor (IL-9R) (CD... | 28 | 6.0 |
---|
>CHIA_HUMAN (Q9BZP6) Acidic mammalian chitinase precursor (EC 3.2.1.14)| (AMCase) (TSA1902) Length = 476 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = -3 Query: 187 SIYVVLCFSYNWSLFS*GLEGTMATNYAACLCVLACVGFVLR 62 S Y + C+ NW+ + GL M N CLC F R Sbjct: 20 SAYQLTCYFTNWAQYRPGLGRFMPDNIDPCLCTHLIYAFAGR 61
>NUCM_TRYBB (P21301) NADH-ubiquinone oxidoreductase 49 kDa subunit homolog (EC| 1.6.5.3) (NADH dehydrogenase subunit 7 homolog) Length = 386 Score = 28.1 bits (61), Expect = 6.0 Identities = 17/55 (30%), Positives = 23/55 (41%) Frame = -2 Query: 191 HLHLCGIVLFVQLELVFVGTRGYHGYKLCCLFVCLGMCWICTALVCRHVHSMLCF 27 +L L G+ F +LVF G L LGM W C C ++ M C+ Sbjct: 200 YLRLRGLSFFDLYDLVFNSLSGV-------LSRSLGMVWDCRLFSCYELYFMFCY 247
>IL9R_HUMAN (Q01113) Interleukin-9 receptor precursor (IL-9R) (CD129 antigen)| Length = 522 Score = 28.1 bits (61), Expect = 6.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 169 CFSYNWSLFS*GLEGTMATNYAACLCVLACV 77 C W+L S L M T AC+C+ CV Sbjct: 6 CIWEGWTLESEALRRDMGTWLLACICICTCV 36 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,828,289 Number of Sequences: 219361 Number of extensions: 606235 Number of successful extensions: 1497 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1496 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)