| Clone Name | rbart53h07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CTR9_YEAST (P89105) Protein CTR9 | 32 | 0.57 | 2 | ACCN3_RAT (O35240) Amiloride-sensitive cation channel 3 (Acid-se... | 30 | 1.3 | 3 | ACCN3_MOUSE (Q6X1Y6) Amiloride-sensitive cation channel 3 (Acid-... | 30 | 1.3 | 4 | ACCN3_HUMAN (Q9UHC3) Amiloride-sensitive cation channel 3 (Acid-... | 29 | 3.7 | 5 | ARD3_ORYSA (Q7XNS7) Putative 1,2-dihydroxy-3-keto-5-methylthiope... | 28 | 4.8 |
|---|
>CTR9_YEAST (P89105) Protein CTR9| Length = 1077 Score = 31.6 bits (70), Expect = 0.57 Identities = 21/78 (26%), Positives = 33/78 (42%), Gaps = 1/78 (1%) Frame = +3 Query: 9 HWLDVPCKDCNHRPFEKNLHALHLLLPFIYNKLARSQ*ASLHTPNTY-HWAITRLVGLQP 185 HWL + CNH + + + + L N S+ ASLHT T+ H + + L Sbjct: 58 HWLTIALAYCNHGKTNEGIKLIEMALDVFQN----SERASLHTFLTWAHLNLAKGQSLSV 113 Query: 186 ATSARTTTESHLAAADVV 239 T T++ L D + Sbjct: 114 ETKEHELTQAELNLKDAI 131
>ACCN3_RAT (O35240) Amiloride-sensitive cation channel 3 (Acid-sensing ion| channel 3) (ASIC3) (Dorsal root ASIC) (DRASIC) Length = 533 Score = 30.4 bits (67), Expect = 1.3 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +3 Query: 135 TPNTYHWAITRLVGLQPATSA 197 TPN HWA T L+GL PA A Sbjct: 104 TPNDLHWAGTALLGLDPAEHA 124
>ACCN3_MOUSE (Q6X1Y6) Amiloride-sensitive cation channel 3 (Acid-sensing ion| channel 3) (ASIC3) (Dorsal root ASIC) (DRASIC) Length = 530 Score = 30.4 bits (67), Expect = 1.3 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +3 Query: 135 TPNTYHWAITRLVGLQPATSA 197 TPN HWA T L+GL PA A Sbjct: 104 TPNDLHWAGTALLGLDPAEHA 124
>ACCN3_HUMAN (Q9UHC3) Amiloride-sensitive cation channel 3 (Acid-sensing ion| channel 3) (ASIC3) (hASIC3) (Testis sodium channel 1) (hTNaC1) Length = 531 Score = 28.9 bits (63), Expect = 3.7 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 135 TPNTYHWAITRLVGLQPATSA 197 TPN HWA + L+GL PA A Sbjct: 103 TPNDLHWAGSALLGLDPAEHA 123
>ARD3_ORYSA (Q7XNS7) Putative 1,2-dihydroxy-3-keto-5-methylthiopentene| dioxygenase 3 (EC 1.13.-.-) (Aci-reductone dioxygenase 3) Length = 206 Score = 28.5 bits (62), Expect = 4.8 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +1 Query: 109 LDHNELACIPQIHTIGPSHDWLACNLPHQHAPRRNPTL 222 LD N ++ + GP DW A N PH H P R L Sbjct: 150 LDTNNYIKTMRLFSGGP--DWTAYNRPHDHLPERKKYL 185 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,294,330 Number of Sequences: 219361 Number of extensions: 755174 Number of successful extensions: 2323 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2323 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)